G00912UN

From GPTWiki
Jump to navigation Jump to search

Name(s) H5N4S2
A2G2S2
HexNAc(4)Hex(5)NeuAc(2)
Molecular Weight 2222.78300589
Class(es) N-Glycan
GlyGen

G00912UN

GNOme

G00912UN

Topologies

Samples (Peptides)

HEK293 Cells (3 / 227), Human ACE2 Protein (2 / 227), Human Serum (223 / 227)

Peptides

 PeptideMol. Wt.ProteinSiteTrans. GroupsTransitions
PE000022R.GCSCFSDWQGPGCSVPVPAN[H5N4S2]QSFWTR.E5,209.042O75882N32514
PE000531R.N[H5N4S2]HSCSEGQISIFR.Y3,756.482O75882N731422
PE000674K.MPSQAPTGNFYPQPLLN[H5N4S2]SSMCLEDSR.Y5,162.108O75882N104324
PE001212K.TELFSSSCPGGIMLN[H5N4S2]ETGQGYQR.F4,753.925O95445N13536
PE000235K.EHEGAIYPDN[H5N4S2]TTDFQR.A4,114.617P00450N1382428
PE000263K.NLASRPYTFHSHGITYYKEHEGAIYPDN[H5N4S2]TTDFQR.A6,250.671P00450N138436
PE000679R.PYTFHSHGITYYKEHEGAIYPDN[H5N4S2]TTDFQR.A5,709.374P00450N138115
PE000007K.AGLQAFFQVQECN[H5N4S2]K.S3,861.565P00450N3581427
PE000589K.EN[H5N4S2]LTAPGSDSAVFFEQGTTR.I4,348.775P00450N3971618
PE000665K.ELHHLQEQN[H5N4S2]VSNAFLDKGEFYIGSK.Y5,125.208P00450N762631
PE000480K.ELHHLQEQN[H5N4S2]VSNAFLDK.G4,243.780P00450N7621427
PE000550R.YPHKPEIN[H5N4S2]STTHPGADLQENFCR.N4,933.039P00734N1431755
PE001836K.SPQELLCGASLISDRWVLTAAHCLLYPPWDKN[H5N4S2]FTENDLLVR.I7,020.188P00734N416115
PE000598K.N[H5N4S2]FTENDLLVR.I3,442.403P00734N41637
PE000240R.WVLTAAHCLLYPPWDKN[H5N4S2]FTENDLLVR.I5,393.384P00734N416423
PE000638K.EHEAQSN[H5N4S2]ASLDVFLGHTNVEELMK.L4,920.053P00736N514429
PE000041K.M[Ox]VSHHN[H5N4S2]LTTGATLINEQWLLTTAK.N4,917.163P00738N1842840
PE001433K.GSFPWQAKMVSHHN[H5N4S2]LTTGATLINEQWLLTTAK.N5,802.613P00738N184112
PE000015K.MVSHHN[H5N4S2]LTTGATLINEQWLLTTAK.N4,901.168P00738N1845175
PE000599K.NLFLN[H5N4S2]HSENATAK.D3,680.509P00738N207212
PE001394K.QLVEIEKVVLHPN[H5N4S2]YSQVDIGLIK.L4,856.262P00738N241214
PE001430K.VVLHPN[H5N4S2]YSQVDIGLIKLKQK.V4,514.120P00738N241114
PE000053K.VVLHPN[H5N4S2]YSQVDIGLIK.L4,016.787P00738N2414042
PE001279R.GNVAVTVSGHTCQHWSAQTPHTHN[H5N4S2]R.T5,004.073P00747N308518
PE001453R.N[H5N4S2]HSCEPCQTLAVR.S3,793.481P00748N433110
PE000654R.SPYYN[H5N4S2]VSDEISFHCYDGYTLR.G4,807.900P00751N122513
PE000102K.IVLDPSGSMNIYLVLDGSDSIGASN[H5N4S2]FTGAK.K5,263.289P00751N285310
PE000416K.KALQAVYSMMSWPDDVPPEGWN[H5N4S2]R.T4,899.029P00751N378534
PE001804K.LGACN[H5N4S2]DTLQQLM[Ox]EVFKFDTISEK.T4,925.076P01008N128210
PE001382K.LGACN[H5N4S2]DTLQQLM[Ox]EVFK.F4,104.679P01008N12828
PE000369K.LGACN[H5N4S2]DTLQQLMEVFKFDTISEK.T4,909.081P01008N128633
PE000111K.LGACN[H5N4S2]DTLQQLMEVFK.F4,088.685P01008N128819
PE000370K.SLTFN[H5N4S2]ETYQDISELVYGAK.L4,399.836P01008N1871431
PE001875K.WVSN[H5N4S2]K.T2,855.111P01008N22426
PE001316R.AAINKWVSN[H5N4S2]KTEGR.I3,795.620P01008N224227
PE001185R.QLAHQSN[H5N4S2]STNIFFSPVSIATAFAMLSLGTK.A5,403.411P01009N7017
PE001184R.QLAHQSN[H5N4S2]STNIFFSPVSIATAFAM[Ox]LSLGTK.A5,419.406P01009N70516
PE000242K.ADTHDEILEGLNFN[H5N4S2]LTEIPEAQIHEGFQELLR.T5,913.600P01009N1072451
PE000045K.YLGN[H5N4S2]ATAIFFLPDEGK.L3,977.671P01009N2712736
PE000272K.LSSWVLLMKYLGN[H5N4S2]ATAIFFLPDEGKLQHLENELTHDIITK.F6,820.212P01009N271111
PE001183K.KLSSWVLLMKYLGN[H5N4S2]ATAIFFLPDEGK.L5,163.365P01009N271111
PE000247K.YLGN[H5N4S2]ATAIFFLPDEGKLQHLENELTHDIITK.F5,762.613P01009N2712063
PE000243K.QLVLKAPDKNVIFSPLSISTALAFLSLGAHN[H5N4S2]TTLTEILK.G6,386.144P01011N93330
PE000270K.APDKNVIFSPLSISTALAFLSLGAHN[H5N4S2]TTLTEILK.G5,804.754P01011N93426
PE000017K.FN[H5N4S2]LTETSEAEIHQSFQHLLR.T4,621.970P01011N106113
PE000656R.TLN[H5N4S2]QSSDELQLSMGNAMFVK.E4,434.833P01011N127618
PE001247K.YTGN[H5N4S2]ASALFILPDQDKMEEVEAMLLPETLKR.W5,744.562P01011N27115
PE000077K.YTGN[H5N4S2]ASALFILPDQDKMEEVEAMLLPETLK.R5,588.460P01011N27128
PE000068R.VYIHPFHLVIHN[H5N4S2]ESTCEQLAK.A4,757.057P01019N472152
PE000116R.LQAILGVPWKDKN[H5N4S2]CTSR.L4,207.835P01019N170225
... further results