G02815KT

From GPTWiki
Jump to navigation Jump to search

Name(s) H5N2
HexNAc(2)Hex(5)
Molecular Weight 1234.4334268
Class(es) N-Glycan
GlyGen

G02815KT

GNOme

G02815KT

Topologies

Samples (Peptides)

HEK293 Cells (15 / 30), Human ACE2 Protein (1 / 30), Human Serum (5 / 30), NIST IgG Standard (4 / 30), SARS-CoV-2 Spike Protein (5 / 30)

Peptides

 PeptideMol. Wt.ProteinSiteTrans. GroupsTransitions
PE001451K.IDSTGN[H5N2]VTNELR.V2,552.086O75882N416111
PE002063R.VFHIHN[H5N2]ESWVLLTPK.A3,053.412O75882N42818
PE000800K.SLGNVN[H5N2]FTVSAEALESQELCGTEVPSVPEHGR.K4,647.054P01023N8691522
PE000849K.TVLTPATNHM[Ox]GN[H5N2]VTFTIPANR.E3,504.581P01024N85711
PE000796K.TVLTPATNHMGN[H5N2]VTFTIPANR.E3,488.586P01024N851211
PE000718K.TKPREEQYN[H5N2]STYRVVSVLTVLHQDWLNGKEYK.C5,114.424P01857N18016
PE000717R.EEQYN[H5N2]STYRVVSVLTVLHQDWLNGK.E4,211.927P01857N18015
PE000702K.TKPREEQYN[H5N2]STYR.V2,905.235P01857N1801127
PE000693R.EEQYN[H5N2]STYR.V2,422.938P01857N180623
PE000774R.LSLHRPALEDLLLGSEAN[H5N2]LTCTLTGLR.D4,197.024P01876N144515
PE000774R.LSLHRPALEDLLLGSEAN[H5N2]LTCTLTGLR.D4,197.024P01877N131515
PE002032K.GSLSYLN[H5N2]VTR.K2,343.021P07339N26314
PE001565K.TQSLLIVNN[H5N2]ATNVVIK.V2,960.432P0DTC2N122211
PE001492R.DLPQGFSALEPLVDLPIGIN[H5N2]ITR.F3,711.786P0DTC2N234313
PE001590K.YNEN[H5N2]GTITDAVDCALDPLSETK.C3,659.529P0DTC2N28226
PE001593R.AGCLIGAEHVN[H5N2]NSYECDIPIGAGICASYQTQTNSPR.R5,157.201P0DTC2N65716
PE001540K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H5N2]FTTAPAICHDGK.A5,785.659P0DTC2N1074217
PE001956R.GVFITN[H5N2]ETGQPLIGK.V2,807.285P10253N470214
PE001262R.GHTLTLN[H5N2]FTR.N2,393.048P11279N103612
PE001990R.VQPFN[H5N2]VTQGK.Y2,351.026P13473N356115
PE001263K.HNN[H5N2]DTQHIWESDSNEFSVIADPR.G3,944.634P14625N217510
PE001892K.GN[H5N2]ETIVNLIHSTR.I2,687.202P16870N13925
PE001269R.VVRPDSELGERPPEDN[H5N2]QSFQYDHEAFLGKEDSK.T5,052.215Q15293N53319
PE002027R.AN[H5N2]ESRLEEADQLYR.Q2,927.240Q6ZXV5N541111
PE002191R.VYCN[H5N2]LSAAHTFEDLK.N3,001.263Q92626N117815
PE001993K.WSLSVKN[H5N2]FTMNEK.L2,817.215Q92820N203112
PE002046K.TYAIYDLLDTAMIN[H5N2]NSR.N3,207.390Q969N2N327110
PE001694K.LQLQALQQN[H5N2]GSSVLSEDK.S3,191.445Q9BYF1N10316
PE002042K.SYAGFLTVN[H5N2]K.T2,333.004Q9H3G5N8116
PE001980R.QAIHVGN[H5N2]QTFNDGTIVEK.Y3,204.419Q9H3G5N346110
PE001937R.AGPN[H5N2]GTLFVADAYK.G2,657.148Q9HDC9N160312