G06850XD

From GPTWiki
Jump to navigation Jump to search

Name(s) H3N3
HexNAc(3)Hex(3)
Molecular Weight 1113.40715301
Class(es) N-Glycan
GlyGen

G06850XD

GNOme

G06850XD

Topologies

Samples (Peptides)

Human ACE2 Protein (7 / 12), NIST IgG Standard (2 / 12), SARS-CoV-2 Spike Protein (3 / 12)

Peptides

 PeptideMol. Wt.ProteinSiteTrans. GroupsDIA Trans. Groups
PE002170K.TKPREEQYN[H3N3]STYR.V2,784.208P01857N180110
PE002167R.EEQYN[H3N3]STYR.V2,301.912P01857N18080
PE001658K.TQSLLIVNN[H3N3]ATNVVIK.V2,839.406P0DTC2N12210
PE001646R.DLPQGFSALEPLVDLPIGIN[H3N3]ITR.F3,590.760P0DTC2N23420
PE001648R.EGVFVSN[H3N3]GTHWFVTQR.N2,976.314P0DTC2N109820
PE001796K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H3N3]ITEENVQNMNNAGDKWSAFLK.E6,757.003Q9BYF1N5310
PE001712K.LQLQALQQN[H3N3]GSSVLSEDKSK.R3,285.546Q9BYF1N10340
PE001695K.LQLQALQQN[H3N3]GSSVLSEDK.S3,070.419Q9BYF1N10320
PE001750K.SIGLLSPDFQEDN[H3N3]ETEINFLLK.Q3,634.666Q9BYF1N43210
PE001675K.HEGPLHKCDISN[H3N3]STEAGQK.L3,220.382Q9BYF1N54620
PE001769R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H3N3]STEAGQK.L5,147.312Q9BYF1N54620
PE001687R.ISFNFFVTAPKN[H3N3]VSDIIPR.T3,277.575Q9BYF1N69010