G10339FR

From GPTWiki
Jump to navigation Jump to search

Name(s) H4N3F
HexNAc(3)Hex(4)Fuc(1)
HexNAc(3)Hex(4)dHex(1)
Molecular Weight 1421.5178847
Class(es) N-Glycan
GlyGen

G10339FR

GNOme

G10339FR

Topologies

Samples (Peptides)

Human ACE2 Protein over-expressed in HEK293 Cells (3 / 13), Human Serum (2 / 13), NIST IgG Standard Reference (5 / 13), SARS-CoV-2 Spike Protein (R683A, R685A) over-expressed in HEK293 Cells (3 / 13)

Peptides

 PeptideMol. Wt.ProteinSiteTrans. GroupsTransitions
PE000968K.TKPREEQYN[H4N3F]STYRVVSVLTVLHQDWLNGKEYK.C5,301.509P01857N180323
PE000948K.TKPREEQYN[H4N3F]STYR.V3,092.319P01857N1801133
PE000970R.EEQYN[H4N3F]STYRVVSVLTVLHQDWLNGK.E4,399.011P01857N180114
PE000973K.TKPREEQYN[H4N3F]STYRVVSVLTVLHQDWLNGK.E4,881.308P01857N180110
PE000938R.EEQYN[H4N3F]STYR.V2,610.023P01857N1801228
PE001156R.ADGTVNQIEGEATPVN[H4N3F]LTEPAKLEVK.F4,143.920P05090N98114
PE001442R.ADGTVNQIEGEATPVN[H4N3F]LTEPAK.L3,674.630P05090N9819
PE001567K.TQSLLIVNN[H4N3F]ATNVVIK.V3,147.517P0DTC2N122110
PE001542K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H4N3F]FTTAPAICHDGK.A5,972.744P0DTC2N1074330
PE001507R.EGVFVSN[H4N3F]GTHWFVTQR.N3,284.424P0DTC2N1098112
PE001714K.LQLQALQQN[H4N3F]GSSVLSEDKSK.R3,593.657Q9BYF1N103214
PE001771R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H4N3F]STEAGQK.L5,455.423Q9BYF1N546120
PE001676K.HEGPLHKCDISN[H4N3F]STEAGQK.L3,528.493Q9BYF1N546219