G15486FH

From GPTWiki
Jump to navigation Jump to search

Name(s) H5N3F
HexNAc(3)Hex(5)dHex(1)
HexNAc(3)Hex(5)Fuc(1)
Molecular Weight 1583.57070888
Class(es) N-Glycan
GlyGen

G15486FH

GNOme

G15486FH

Topologies

Samples (Peptides)

Human ACE2 Protein (2 / 11), NIST IgG Standard (5 / 11), SARS-CoV-2 Spike Protein (4 / 11)

Peptides

 PeptideMol. Wt.ProteinSiteTrans. GroupsTransitions
PE002174K.TKPREEQYN[H5N3F]STYRVVSVLTVLHQDWLNGKEYK.C5,463.561P01857N180226
PE002172R.EEQYN[H5N3F]STYRVVSVLTVLHQDWLNGK.E4,561.064P01857N180115
PE002171K.TKPREEQYN[H5N3F]STYR.V3,254.372P01857N1801144
PE002168R.EEQYN[H5N3F]STYR.V2,772.075P01857N180732
PE002173R.EEQYN[H5N3F]STYRVVSVLTVLHQDWLNGKEYK.C4,981.265P01857N180112
PE001659K.TQSLLIVNN[H5N3F]ATNVVIK.V3,309.570P0DTC2N122212
PE001647R.DLPQGFSALEPLVDLPIGIN[H5N3F]ITR.F4,060.924P0DTC2N234111
PE001652K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H5N3F]FTTAPAICHDGK.A6,134.796P0DTC2N1074433
PE001649R.EGVFVSN[H5N3F]GTHWFVTQR.N3,446.477P0DTC2N1098217
PE001697K.LQLQALQQN[H5N3F]GSSVLSEDK.S3,540.582Q9BYF1N103211
PE001780K.HEGPLHKCDISN[H5N3F]STEAGQK.L3,690.546Q9BYF1N546114