G25987BV

From GPTWiki
Jump to navigation Jump to search

Name(s) H3N4F
HexNAc(4)Hex(3)Fuc(1)
HexNAc(4)Hex(3)dHex(1)
Molecular Weight 1462.544434
Class(es) N-Glycan
GlyGen

G25987BV

GNOme

G25987BV

Topologies

Samples (Peptides)

HEK293 Cells (2 / 33), Human ACE2 Protein (11 / 33), Human Serum (11 / 33), NIST IgG Standard (8 / 33), SARS-CoV-2 Spike Protein (5 / 33)

Peptides

 PeptideMol. Wt.ProteinSiteTrans. GroupsDIA Trans. Groups
PE001256K.GHDLNEDGLVSWEEYKN[H3N4F]ATYGYVLDDPDPDDGFNYK.Q5,612.347O43852N13110
PE000715K.FNWYVDGVEVHNAKTKPREEQYN[H3N4F]STYR.V4,792.130P01857N18020
PE000713K.TKPREEQYN[H3N4F]STYRVVSVLTVLHQDWLNGKEYK.C5,342.535P01857N180150
PE000694R.EEQYN[H3N4F]STYR.V2,651.049P01857N180196
PE000709K.PREEQYN[H3N4F]STYR.V2,904.203P01857N18050
PE000708R.EEQYN[H3N4F]STYRVVSVLTVLHQDWLNGK.E4,440.038P01857N18090
PE000711K.TKPREEQYN[H3N4F]STYRVVSVLTVLHQDWLNGK.E4,922.334P01857N180100
PE000703K.TKPREEQYN[H3N4F]STYR.V3,133.346P01857N180304
PE000700R.EEQYN[H3N4F]STYRVVSVLTVLHQDWLNGKEYK.C4,860.239P01857N180160
PE000798R.EEQFN[H3N4F]STFR.V2,619.059P01859N1761310
PE000785K.TKPREEQFN[H3N4F]STFR.V3,101.356P01859N176247
PE001405R.EEQFN[H3N4F]STFRVVSVLTVVHQDWLNGKEYK.C4,814.233P01859N17610
PE001431R.EEQFN[H3N4F]STFRVVSVLTVVHQDWLNGK.E4,394.032P01859N17610
PE000787K.TKPREEQFN[H3N4F]STYR.V3,117.351P01861N17720
PE001409R.EEQFN[H3N4F]STYRVVSVLTVLHQDWLNGKEYK.C4,844.244P01861N17741
PE001435R.EEQFN[H3N4F]STYR.V2,635.054P01861N17798
PE001569K.TQSLLIVNN[H3N4F]ATNVVIK.V3,188.543P0DTC2N12220
PE001580K.VCEFQFCNDPFLGVYYHKNN[H3N4F]K.S4,140.749P0DTC2N14920
PE001485K.DFGGFN[H3N4F]FSQILPDPSKPSKR.S3,698.672P0DTC2N80110
PE001543K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H3N4F]FTTAPAICHDGK.A6,013.770P0DTC2N107420
PE001512R.EGVFVSN[H3N4F]GTHWFVTQR.N3,325.451P0DTC2N109820
PE001915R.VVRPDSELGERPPEDN[H3N4F]QSFQYDHEAFLGK.E4,821.130Q15293N5330
PE001757K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H3N4F]ITEENVQNMNNAGDKWSAFLK.E7,106.140Q9BYF1N5320
PE001777K.EQSTLAQMYPLQEIQN[H3N4F]LTVK.L3,795.738Q9BYF1N9010
PE001734K.LQLQALQQN[H3N4F]GSSVLSEDKSKR.L3,790.784Q9BYF1N10320
PE001717K.LQLQALQQN[H3N4F]GSSVLSEDKSK.R3,634.683Q9BYF1N10340
PE001698K.LQLQALQQN[H3N4F]GSSVLSEDK.S3,419.556Q9BYF1N10340
PE001682R.IFKEAEKFFVSVGLPN[H3N4F]MTQGFWENSMLTDPGNVQK.A5,450.498Q9BYF1N32210
PE001792K.SIGLLSPDFQEDN[H3N4F]ETEINFLLK.Q3,983.803Q9BYF1N43210
PE001666K.CDISN[H3N4F]STEAGQKLFNMLR.L3,545.527Q9BYF1N54610
PE001772R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H3N4F]STEAGQK.L5,496.450Q9BYF1N54630
PE001677K.HEGPLHKCDISN[H3N4F]STEAGQK.L3,569.520Q9BYF1N54630
PE001689R.ISFNFFVTAPKN[H3N4F]VSDIIPR.T3,626.713Q9BYF1N69020