G39446WN

From GPTWiki
Jump to navigation Jump to search

Name(s) H5N3
HexNAc(3)Hex(5)
Molecular Weight 1437.5127994
Class(es) N-Glycan
GlyGen

G39446WN

GNOme

G39446WN

Topologies

Samples (Peptides)

Human ACE2 Protein (1 / 7), NIST IgG Standard (2 / 7), SARS-CoV-2 Spike Protein (4 / 7)

Peptides

 PeptideMol. Wt.ProteinSiteTrans. GroupsTransitions
PE000958R.EEQYN[H5N3]STYR.V2,626.018P01857N180316
PE000951K.TKPREEQYN[H5N3]STYR.V3,108.314P01857N180826
PE001571K.TQSLLIVNN[H5N3]ATNVVIK.V3,163.512P0DTC2N12219
PE001498R.DLPQGFSALEPLVDLPIGIN[H5N3]ITR.F3,914.866P0DTC2N234314
PE001616K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H5N3]FTTAPAICHDGK.A5,988.738P0DTC2N107417
PE001515R.EGVFVSN[H5N3]GTHWFVTQR.N3,300.419P0DTC2N109828
PE001789K.N[H5N3]VSDIIPR.T2,350.016Q9BYF1N69017