G44211QA

From GPTWiki
Jump to navigation Jump to search

Name(s) H6N5F
A3G3F1
FA3G3
HexNAc(5)Hex(6)Fuc(1)
HexNAc(5)Hex(6)dHex(1)
Molecular Weight 2151.78227759
Class(es) N-Glycan
GlyGen

G44211QA

GNOme

G44211QA

Topologies

Samples (Peptides)

Human Serum (11 / 15), NIST IgG Standard (2 / 15), SARS-CoV-2 Spike Protein (2 / 15)

Peptides

 PeptideMol. Wt.ProteinSiteTrans. GroupsTransitions
PE000377Q.SN[H6N5F]STNIFFSPVSIATAFAMLSLGTK.A4,755.113P01009N70110
PE000381S.N[H6N5F]STNIFFSPVSIATAFAMLSLGTK.A4,668.081P01009N70114
PE000386R.EEQYN[H6N5F]STYR.V3,340.287P01857N180513
PE000389K.TKPREEQYN[H6N5F]STYR.V3,822.584P01857N1801042
PE000413K.STGKPTLYN[H6N5F]VSLVM[Ox]SDT.A3,979.675P01871N44014
PE001174R.LSLHRPALEDLLLGSEAN[H6N5F]LTCTLTGLR.D5,114.373P01876N144314
PE001174R.LSLHRPALEDLLLGSEAN[H6N5F]LTCTLTGLR.D5,114.373P01877N131314
PE000405A.MFGN[H6N5F]DTITCTTHGNWTK.L4,134.644P02749N18317
PE000411R.QLDMLDLSN[H6N5F]NSLASVPEGLWASLGQPNWDM.R5,452.325P02750N269111
PE000383N.LVPVPITN[H6N5F]ATLDQITGK.W3,930.796P02763N3319
PE000461R.ADGTVNQIEGEATPVN[H6N5F]LTEPAKLEVK.F4,874.185P05090N9816
PE000384K.MLFVEPILEVSSLPTTN[H6N5F]STTNSAT.K4,703.055P05155N6915
PE001548K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N5F]FTTAPAICHDGK.A6,703.008P0DTC2N1074317
PE001519R.EGVFVSN[H6N5F]GTHWFVTQR.N4,014.689P0DTC2N109826
PE000385K.M[Ox]LN[H6N5F]TSSLLEQLNEQFNWVSRL.A4,689.041P10909N354121
PE000382R.NQALN[H6N5F]LSLAYSFVTPLTSMVVTKPD.D4,860.192Q14624N57719