G47737VJ

From GPTWiki
Jump to navigation Jump to search

Name(s) H5N4F2S
HexNAc(4)Hex(5)Fuc(2)NeuAc(1)
HexNAc(4)Hex(5)dHex(2)NeuAc(1)
Molecular Weight 2223.803406
Class(es) N-Glycan
GlyGen

G47737VJ

GNOme

G47737VJ

Topologies

Samples (Peptides)

HEK293 Cells (1 / 74), Human ACE2 Protein over-expressed in HEK293 Cells (2 / 74), Human Serum (71 / 74), SARS-CoV-2 Spike Protein (R683A, R685A) over-expressed in HEK293 Cells (1 / 74)

Peptides

 PeptideMol. Wt.ProteinSiteTrans. GroupsTransitions
PE000907R.N[H5N4F2S]HSCSEGQISIFR.Y3,757.503O75882N731112
PE001873K.NLASRPYTFHSHGITYYKEHEGAIYPDN[H5N4F2S]TTDFQR.A6,251.691P00450N138116
PE001301K.EHEGAIYPDN[H5N4F2S]TTDFQR.A4,115.637P00450N138114
PE001466K.AGLQAFFQVQECN[H5N4F2S]K.S3,862.586P00450N35817
PE000867K.EN[H5N4F2S]LTAPGSDSAVFFEQGTTR.I4,349.795P00450N397113
PE001220K.ELHHLQEQN[H5N4F2S]VSNAFLDKGEFYIGSK.Y5,126.228P00450N76217
PE001195K.ELHHLQEQN[H5N4F2S]VSNAFLDK.G4,244.800P00450N762112
PE000913R.YPHKPEIN[H5N4F2S]STTHPGADLQENFCR.N4,934.059P00734N14319
PE000825K.MVSHHN[H5N4F2S]LTTGATLINEQWLLTTAK.N4,902.188P00738N184531
PE000822K.M[Ox]VSHHN[H5N4F2S]LTTGATLINEQWLLTTAK.N4,918.183P00738N184114
PE001343K.NLFLNHSEN[H5N4F2S]ATAK.D3,681.530P00738N211113
PE001373K.VVLHPN[H5N4F2S]YSQVDIGLIK.L4,017.807P00738N241323
PE001239K.IVLDPSGSMNIYLVLDGSDSIGASN[H5N4F2S]FTGAK.K5,264.310P00751N28514
PE000804K.ADTHDEILEGLNFN[H5N4F2S]LTEIPEAQIHEGFQELLR.T5,914.620P01009N107236
PE000838R.VYIHPFHLVIHN[H5N4F2S]ESTCEQLAK.A4,758.077P01019N47111
PE000821K.GCVLLSYLN[H5N4F2S]ETVTVSASLESVR.G4,620.029P01023N551017
PE000904K.LNAENN[H5N4F2S]ATFYFK.I3,654.486P01042N29419
PE001827R.IIVPLNNREN[H5N4F2S]ISDPTSPLR.T4,370.973P01591N7118
PE000829R.PALEDLLLGSEAN[H5N4F2S]LTCTLTGLR.D4,580.034P01876N144321
PE001335R.LAGKPTHVN[H5N4F2S]VSVVMAEVDGTCY.-4,569.938P01876N34016
PE000829P01877N131
PE001207R.GTAGNALMDGASQLMGEN[H5N4F2S]R.T4,115.655P02675N394219
PE001325R.GTAGNALMDGASQLM[Ox]GEN[H5N4F2S]R.T4,131.650P02675N394219
PE001324R.GTAGNALM[Ox]DGASQLMGEN[H5N4F2S]R.T4,131.650P02675N39419
PE001840R.VYKPSAGN[H5N4F2S]NSLYR.D3,691.550P02749N162113
PE001482K.LPPGLLAN[H5N4F2S]FTLLR.T3,647.659P02750N186111
PE001803R.KLPPGLLAN[H5N4F2S]FTLLR.T3,775.753P02750N186114
PE001824R.DQCIVDDITYNVN[H5N4F2S]DTFHK.R4,419.783P02751N528118
PE000930K.LDAPTNLQFVN[H5N4F2S]ETDSTVLVR.W4,454.947P02751N1007310
PE000908R.QDQCIYN[H5N4F2S]TTYLNVQR.E4,138.693P02763N9317
PE000751R.KVCQDCPLLAPLN[H5N4F2S]DTR.V4,122.738P02765N156124
PE000756K.VCQDCPLLAPLN[H5N4F2S]DTR.V3,994.643P02765N156141
PE000749K.AALAAFNAQNN[H5N4F2S]GSNFQLEEISR.A4,587.949P02765N176470
PE001812K.CGLVPVLAENYN[H5N4F2S]KSDNCEDTPEAGYFAIAVVK.K5,766.473P02787N432111
PE001821K.CGLVPVLAENYN[H5N4F2S]K.S3,699.548P02787N432110
PE001370R.QQQHLFGSN[H5N4F2S]VTDCSGNFCLFR.S4,737.920P02787N630425
PE001211R.SWPAVGN[H5N4F2S]CSSALR.W3,627.465P02790N187311
PE001439R.NGTGHGN[H5N4F2S]STHHGPEYM[Ox]R.C4,090.585P02790N246119
PE001843K.ALPQPQN[H5N4F2S]VTSLLGCTH.-3,958.676P02790N453114
PE001338K.LETTVN[H5N4F2S]YTDSQRPICLPSK.G4,444.908P03951N491110
PE001228K.IYPGVDFGGEELN[H5N4F2S]VTFVK.G4,206.802P03952N308110
PE001829R.IVGGTN[H5N4F2S]SSWGEWPWQVSLQVK.L4,580.984P03952N39617
PE001384K.LQAPLN[H5N4F2S]YTEFQKPICLPSK.G4,469.980P03952N494111
PE001201K.NN[H5N4F2S]ATVHEQVGGPSLTSDLQAQSK.G4,603.965P04004N86112
PE001241R.PETLHPGRPQPPAEEELCSGKPFDAFTDLKN[H5N4F2S]GSLFAFR.G6,478.883P04004N169118
PE000808K.GNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKN[H5N4F2S]GSLFAFR.G9,688.467P04004N16918
PE001307R.HSHNN[H5N4F2S]NSSDLHPHK.H3,846.533P04196N344113
PE000911R.REGDHEFLEVPEAQEDVEATFPVHQPGN[H5N4F2S]YSCSYR.T6,215.574P04217N179121
PE001377R.FQSPAGTEALFELHNISVADSAN[H5N4F2S]YSCVYVDLKPPFGGSAPSER.L6,851.000P04217N37119
PE001205R.CIQAN[H5N4F2S]YSLMENGK.I3,750.489P05090N6519
... further results