G59937CP

From GPTWiki
Jump to navigation Jump to search

Name(s) H4N4F
HexNAc(4)Hex(4)Fuc(1)
HexNAc(4)Hex(4)dHex(1)
Molecular Weight 1624.597257
Class(es) N-Glycan
GlyGen

G59937CP

GNOme

G59937CP

Topologies

Samples (Peptides)

HEK293 Cells (2 / 30), Human ACE2 Protein (7 / 30), Human Serum (13 / 30), NIST IgG Standard (8 / 30), SARS-CoV-2 Spike Protein (5 / 30)

Peptides

 PeptideMol. Wt.ProteinSiteTrans. GroupsTransitions
PE000706K.TKPREEQYN[H4N4F]STYR.V3,295.399P01857N1803540
PE000712K.TKPREEQYN[H4N4F]STYRVVSVLTVLHQDWLNGK.E5,084.387P01857N180782
PE000714K.TKPREEQYN[H4N4F]STYRVVSVLTVLHQDWLNGKEYK.C5,504.588P01857N1801255
PE000710K.PREEQYN[H4N4F]STYR.V3,066.256P01857N180516
PE000716K.FNWYVDGVEVHNAKTKPREEQYN[H4N4F]STYR.V4,954.183P01857N180214
PE000697R.EEQYN[H4N4F]STYR.V2,813.102P01857N1801736
PE000699R.EEQYN[H4N4F]STYRVVSVLTVLHQDWLNGK.E4,602.091P01857N1801154
PE000701R.EEQYN[H4N4F]STYRVVSVLTVLHQDWLNGKEYK.C5,022.292P01857N1801970
PE000799R.EEQFN[H4N4F]STFR.V2,781.112P01859N176814
PE001432R.EEQFN[H4N4F]STFRVVSVLTVVHQDWLNGKEYK.C4,976.286P01859N176110
PE001294R.EEQFN[H4N4F]STFRVVSVLTVVHQDWLNGK.E4,556.085P01859N176213
PE000786K.TKPREEQFN[H4N4F]STFR.V3,263.409P01859N1761625
PE001436R.EEQFN[H4N4F]STYR.V2,797.107P01861N177212
PE000788K.TKPREEQFN[H4N4F]STYR.V3,279.404P01861N177824
PE001410R.EEQFN[H4N4F]STYRVVSVLTVLHQDWLNGKEYK.C5,006.297P01861N177320
PE001407R.EEQFN[H4N4F]STYRVVSVLTVLHQDWLNGK.E4,586.096P01861N177110
PE001371R.QQQHLFGSN[H4N4F]VTDCSGNFCLFR.S4,138.714P02787N63015
PE001573K.TQSLLIVNN[H4N4F]ATNVVIK.V3,350.596P0DTC2N122213
PE001638K.VCEFQFCNDPFLGVYYHKNN[H4N4F]K.S4,302.802P0DTC2N149112
PE001596K.DFGGFN[H4N4F]FSQILPDPSKPSKR.S3,860.725P0DTC2N801114
PE001549K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H4N4F]FTTAPAICHDGK.A6,175.823P0DTC2N1074120
PE001526R.EGVFVSN[H4N4F]GTHWFVTQR.N3,487.504P0DTC2N1098113
PE002188K.GN[H4N4F]ETIVNLIHSTR.I3,077.366P16870N139112
PE001764K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H4N4F]ITEENVQNMNNAGDKWSAFLK.E7,268.193Q9BYF1N53111
PE001725K.LQLQALQQN[H4N4F]GSSVLSEDKSK.R3,796.736Q9BYF1N103111
PE001705K.LQLQALQQN[H4N4F]GSSVLSEDK.S3,581.609Q9BYF1N103212
PE001794K.SIGLLSPDFQEDN[H4N4F]ETEINFLLK.Q4,145.856Q9BYF1N43214
PE001679K.HEGPLHKCDISN[H4N4F]STEAGQK.L3,731.573Q9BYF1N546115
PE001691R.ISFNFFVTAPKN[H4N4F]VSDIIPR.T3,788.765Q9BYF1N69019
PE001746K.N[H4N4F]VSDIIPR.T2,537.100Q9BYF1N69026