G80475RE

From GPTWiki
Jump to navigation Jump to search

Name(s) H3N3F
HexNAc(3)Hex(3)Fuc(1)
HexNAc(3)Hex(3)dHex(1)
Molecular Weight 1259.4650613
Class(es) N-Glycan
GlyGen

G80475RE

GNOme

G80475RE

Topologies

Samples (Peptides)

HEK293 Cells (2 / 16), Human ACE2 Protein over-expressed in HEK293 Cells (7 / 16), NIST IgG Standard Reference (5 / 16), SARS-CoV-2 Spike Protein (R683A, R685A) over-expressed in HEK293 Cells (2 / 16)

Peptides

 PeptideMol. Wt.ProteinSiteTrans. GroupsTransitions
PE001274R.EEQYN[H3N3F]STYRVVSVLTVLHQDWLNGKEYK.C4,657.159P01857N180326
PE001273K.TKPREEQYN[H3N3F]STYR.V2,930.266P01857N1801238
PE001272R.EEQYN[H3N3F]STYR.V2,447.970P01857N180931
PE001275K.TKPREEQYN[H3N3F]STYRVVSVLTVLHQDWLNGKEYK.C5,139.456P01857N180323
PE001276K.TKPREEQYN[H3N3F]STYRVVSVLTVLHQDWLNGK.E4,719.255P01857N180112
PE001576K.TQSLLIVNN[H3N3F]ATNVVIK.V2,985.464P0DTC2N12218
PE001611R.EGVFVSN[H3N3F]GTHWFVTQR.N3,122.371P0DTC2N109819
PE001919R.VVRPDSELGERPPEDN[H3N3F]QSFQYDHEAFLGK.E4,618.051Q15293N53125
PE001270R.VVRPDSELGERPPEDN[H3N3F]QSFQYDHEAFLGKEDSK.T5,077.247Q15293N5315
PE001708K.LQLQALQQN[H3N3F]GSSVLSEDK.S3,216.477Q9BYF1N10329
PE001729K.LQLQALQQN[H3N3F]GSSVLSEDKSK.R3,431.604Q9BYF1N103424
PE001667K.EAEKFFVSVGLPN[H3N3F]MTQGFWENSMLTDPGNVQK.A4,859.172Q9BYF1N32228
PE001685R.IFKEAEKFFVSVGLPN[H3N3F]MTQGFWENSMLTDPGNVQK.A5,247.419Q9BYF1N32219
PE001773R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H3N3F]STEAGQK.L5,293.370Q9BYF1N546230
PE001680K.HEGPLHKCDISN[H3N3F]STEAGQK.L3,366.440Q9BYF1N546114
PE001692R.ISFNFFVTAPKN[H3N3F]VSDIIPR.T3,423.633Q9BYF1N69019