G83555HU

From GPTWiki
Jump to navigation Jump to search

Name(s) H5N4F
A2G2F1
FA2G2
HexNAc(4)Hex(5)Fuc(1)
HexNAc(4)Hex(5)dHex(1)
Molecular Weight 1786.65008149
Class(es) N-Glycan
GlyGen

G83555HU

GNOme

G83555HU

Topologies

Samples (Peptides)

HEK293 Cells (1 / 39), Human ACE2 Protein over-expressed in HEK293 Cells (7 / 39), Human Serum (21 / 39), NIST IgG Standard Reference (8 / 39), SARS-CoV-2 Spike Protein (R683A, R685A) over-expressed in HEK293 Cells (5 / 39)

Peptides

 PeptideMol. Wt.ProteinSiteTrans. GroupsTransitions
PE001402K.VVLHPN[H5N4F]YSQVDIGLIK.L3,580.654P00738N24119
PE002177R.QLAHQSN[H5N4F]STNIFFSPVSIATAFAMLSLGTK.A4,967.278P01009N7015
PE001284R.TEVSSNHVLIYLDKVSN[H5N4F]QTLSLFFTVLQDVPVR.D5,547.654P01023N142414
PE000397K.PREEQYN[H5N4F]STYR.V3,228.309P01857N180415
PE000393R.EEQYN[H5N4F]STYRVVSVLTVLHQDWLNGKEYK.C5,184.344P01857N180718
PE000387R.EEQYN[H5N4F]STYR.V2,975.155P01857N1801830
PE000396K.TKPREEQYN[H5N4F]STYRVVSVLTVLHQDWLNGK.E5,246.440P01857N180221
PE000394K.FNWYVDGVEVHNAKTKPREEQYN[H5N4F]STYR.V5,116.235P01857N18016
PE000392R.EEQYN[H5N4F]STYRVVSVLTVLHQDWLNGK.E4,764.143P01857N180424
PE000390K.TKPREEQYN[H5N4F]STYR.V3,457.451P01857N1802853
PE000395K.TKPREEQYN[H5N4F]STYRVVSVLTVLHQDWLNGKEYK.C5,666.641P01857N180552
PE000055K.TKPREEQFN[H5N4F]STFR.V3,425.461P01859N176818
PE001800R.EEQFN[H5N4F]STFR.V2,943.165P01859N17625
PE001295R.EEQFN[H5N4F]STFRVVSVLTVVHQDWLNGKEYK.C5,138.339P01859N176111
PE001277R.EEQFN[H5N4F]STFRVVSVLTVVHQDWLNGK.E4,718.138P01859N17627
PE001408R.EEQFN[H5N4F]STYRVVSVLTVLHQDWLNGK.E4,748.149P01861N17715
PE000056K.TKPREEQFN[H5N4F]STYR.V3,441.456P01861N177124
PE001278R.EEQFN[H5N4F]STYR.V2,959.160P01861N17725
PE000307R.GLTFQQN[H5N4F]ASSMCVPDQDTAIR.V4,124.718P01871N209115
PE000069R.LAGKPTHVN[H5N4F]VSVVMAEVDGTC.Y3,969.722P01876N340226
PE002178K.VFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQN[H5N4F]VTAR.N6,562.004P01877N4714
PE000540R.RNPPMGGNVVIFDTVITNQEEPYQN[H5N4F]HSGR.F5,055.218P02745N146122
PE001355R.VYKPSAGN[H5N4F]NSLYR.D3,254.397P02749N162111
PE001444R.ADGTVNQIEGEATPVN[H5N4F]LTEPAK.L4,039.763P05090N98513
PE000690R.ADGTVNQIEGEATPVN[H5N4F]LTEPAKLEVK.F4,509.053P05090N98122
PE000139R.SPYEMFGDEEVMCLNGN[H5N4F]WTEPPQCK.D4,803.884P08603N109518
PE001577K.TQSLLIVNN[H5N4F]ATNVVIK.V3,512.649P0DTC2N12229
PE001503R.DLPQGFSALEPLVDLPIGIN[H5N4F]ITR.F4,264.003P0DTC2N23414
PE001597K.DFGGFN[H5N4F]FSQILPDPSKPSKR.S4,022.778P0DTC2N801110
PE001553K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H5N4F]FTTAPAICHDGK.A6,337.876P0DTC2N1074226
PE001533R.EGVFVSN[H5N4F]GTHWFVTQR.N3,649.556P0DTC2N1098210
PE000139Q03591N194
PE001896K.AAIPSALDTN[H5N4F]SSK.S3,060.301Q08380N55117
PE001672K.EQSTLAQMYPLQEIQN[H5N4F]LTVK.L4,119.844Q9BYF1N9017
PE001739K.LQLQALQQN[H5N4F]GSSVLSEDKSKR.L4,114.890Q9BYF1N103213
PE001730K.LQLQALQQN[H5N4F]GSSVLSEDKSK.R3,958.789Q9BYF1N103325
PE001709K.LQLQALQQN[H5N4F]GSSVLSEDK.S3,743.662Q9BYF1N103314
PE001774R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H5N4F]STEAGQK.L5,820.555Q9BYF1N546112
PE001748K.N[H5N4F]VSDIIPR.T2,699.153Q9BYF1N69024
PE001781R.ISFNFFVTAPKN[H5N4F]VSDIIPR.T3,950.818Q9BYF1N69018