G85144OK

From GPTWiki
Jump to navigation Jump to search

Name(s) H6N5FS2
HexNAc(5)Hex(6)Fuc(1)NeuAc(2)
HexNAc(5)Hex(6)dHex(1)NeuAc(2)
Molecular Weight 2733.97311
Class(es) N-Glycan
GlyGen

G85144OK

GNOme

G85144OK

Topologies

Samples (Peptides)

HEK293 Cells (2 / 28), Human ACE2 Protein (1 / 28), Human Serum (22 / 28), SARS-CoV-2 Spike Protein (3 / 28)

Peptides

 PeptideMol. Wt.ProteinSiteTrans. GroupsDIA Trans. Groups
PE000858K.EHEGAIYPDN[H6N5FS2]TTDFQR.A4,625.807P00450N13830
PE000864K.ELHHLQEQN[H6N5FS2]VSNAFLDKGEFYIGSK.Y5,636.398P00450N76210
PE000861K.ELHHLQEQN[H6N5FS2]VSNAFLDK.G4,754.970P00450N76220
PE000823K.M[Ox]VSHHN[H6N5FS2]LTTGATLINEQWLLTTAK.N5,428.353P00738N18410
PE000826K.MVSHHN[H6N5FS2]LTTGATLINEQWLLTTAK.N5,412.358P00738N18460
PE001477K.VVLHPN[H6N5FS2]YSQVDIGLIK.L4,527.977P00738N24130
PE000805K.ADTHDEILEGLNFN[H6N5FS2]LTEIPEAQIHEGFQELLR.T6,424.790P01009N10752
PE000853K.VSN[H6N5FS2]QTLSLFFTVLQDVPVR.D4,896.147P01023N142421
PE000870R.HGIQYFNN[H6N5FS2]NTQHSSLFMLNEVK.R5,354.222P01042N16910
PE000873R.HGIQYFNN[H6N5FS2]NTQHSSLFMLNEVKR.A5,510.323P01042N16910
PE001208R.LAGKPTHVN[H6N5FS2]VSVVMAEVDGTC.Y4,917.045P01876N34010
PE000918R.LAGKPTHVN[H6N5FS2]VSVVMAEVDGTCY.-5,080.108P01876N34030
PE001356R.VYKPSAGN[H6N5FS2]NSLYR.D4,201.720P02749N16230
PE000848K.SVQEIQATFFYFTPN[H6N5FS2]KTEDTIFLR.E5,628.422P02763N7230
PE000884R.QQQHLFGSN[H6N5FS2]VTDCSGNFCLFR.S5,248.090P02787N63010
PE000881R.N[H6N5FS2]ISDGFDGIPDNVDAALALPAHSYSGR.E5,505.288P04004N24210
PE001310R.HSHNN[H6N5FS2]NSSDLHPHK.H4,356.703P04196N34410
PE001309R.HSHNNN[H6N5FS2]SSDLHPHK.H4,356.703P04196N34510
PE000894R.ADGTVNQIEGEATPVN[H6N5FS2]LTEPAKLEVK.F5,456.376P05090N9820
PE000729K.IPCSQPPQIEHGTIN[H6N5FS2]SSR.S4,753.953P08603N88210
PE000736R.ISEEN[H6N5FS2]ETTCYMGK.W4,294.617P08603N91110
PE002207K.VCEFQFCNDPFLGVYYHKNN[H6N5FS2]K.S5,412.178P0DTC2N14910
PE001554K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N5FS2]FTTAPAICHDGK.A7,285.199P0DTC2N107420
PE001613R.EGVFVSN[H6N5FS2]GTHWFVTQR.N4,596.879P0DTC2N109810
PE002202R.HN[H6N5FS2]STGCLR.M3,677.403P10909N29110
PE000848K.SVQEIQATFFYFTPN[H6N5FS2]KTEDTIFLR.E5,628.422P19652N7230
PE001897K.AAIPSALDTN[H6N5FS2]SSK.S4,007.625Q08380N55110
PE001389R.NQALN[H6N5FS2]LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR.N7,371.236Q14624N57710
PE001778K.EQSTLAQMYPLQEIQN[H6N5FS2]LTVK.L5,067.167Q9BYF1N9010