G85740DB

From GPTWiki
Jump to navigation Jump to search

Name(s) H5N5F
A3G2F1
FA3G2
HexNAc(5)Hex(5)Fuc(1)
HexNAc(5)Hex(5)dHex(1)
Molecular Weight 1989.7294541
Class(es) N-Glycan
GlyGen

G85740DB

GNOme

G85740DB

Topologies

Samples (Peptides)

Human ACE2 Protein (4 / 23), Human Serum (11 / 23), NIST IgG Standard (2 / 23), SARS-CoV-2 Spike Protein (6 / 23)

Peptides

 PeptideMol. Wt.ProteinSiteTrans. GroupsTransitions
PE000380L.GNVN[H5N5F]FTVSAEALESQELCGTEVPSVPEHGRK.D5,330.329P01023N86916
PE000388R.EEQYN[H5N5F]STYR.V3,178.234P01857N180757
PE000391K.TKPREEQYN[H5N5F]STYR.V3,660.531P01857N1801064
PE001419R.EEQYN[H5N5F]STYRVVSVLTVLHQDWLNGKEYK.C5,387.424P01857N18019
PE000361R.GLTFQQN[H5N5F]ASSMCVPDQDTAIR.V4,327.798P01871N20929
PE000357R.LSLHRPALEDLLLGSEAN[H5N5F]LTCTLTGLR.D4,952.320P01876N144312
PE000340R.LAGKPTHVN[H5N5F]VSVVMAEVDGTC.Y4,172.801P01876N340128
PE000347R.LAGKPTHVN[H5N5F]VSVVMAEVDGTCY.-4,335.864P01876N340135
PE000367K.VFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQN[H5N5F]VTAR.N6,765.084P01877N47110
PE000357P01877N131
PE001348K.TPLTAN[H5N5F]ITK.S2,947.279P01877N20515
PE000378A.DTVHLAVEFFN[H5N5F]LTHLPANLLQGASK.L4,724.174P02750N7916
PE000203R.QQQHLFGSN[H5N5F]VTDCSGNFCLFR.S4,503.846P02787N63015
PE000379Q.IQLCPPPPQIPNSHN[H5N5F]M[Ox]TTTLNYR.D4,697.050P08603N82215
PE001578K.TQSLLIVNN[H5N5F]ATNVVIK.V3,715.728P0DTC2N12215
PE001640K.VCEFQFCNDPFLGVYYHKNN[H5N5F]K.S4,667.934P0DTC2N14914
PE001563K.TPPIKDFGGFN[H5N5F]FSQILPDPSKPSK.R4,606.088P0DTC2N801210
PE001598K.DFGGFN[H5N5F]FSQILPDPSKPSKR.S4,225.857P0DTC2N80118
PE001555K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H5N5F]FTTAPAICHDGK.A6,540.955P0DTC2N1074331
PE001614R.EGVFVSN[H5N5F]GTHWFVTQR.N3,852.636P0DTC2N1098110
PE001673K.EQSTLAQMYPLQEIQN[H5N5F]LTVK.L4,322.923Q9BYF1N9014
PE001710K.LQLQALQQN[H5N5F]GSSVLSEDK.S3,946.741Q9BYF1N10327
PE001788K.LQLQALQQN[H5N5F]GSSVLSEDKSKR.L4,317.969Q9BYF1N103111
PE001785K.LQLQALQQN[H5N5F]GSSVLSEDKSK.R4,161.868Q9BYF1N103118