G88725PI

From GPTWiki
Jump to navigation Jump to search

Name(s) H3N5F
HexNAc(5)Hex(3)Fuc(1)
HexNAc(5)Hex(3)dHex(1)
Molecular Weight 1665.6238064
Class(es) N-Glycan
GlyGen

G88725PI

GNOme

G88725PI

Topologies

Samples (Peptides)

HEK293 Cells (2 / 19), Human ACE2 Protein (6 / 19), Human Serum (5 / 19), NIST IgG Standard (2 / 19), SARS-CoV-2 Spike Protein (6 / 19)

Peptides

 PeptideMol. Wt.ProteinSiteTrans. GroupsDIA Trans. Groups
PE002179K.GHDLNEDGLVSWEEYKN[H3N5F]ATYGYVLDDPDPDDGFNYK.Q5,815.427O43852N13110
PE000956K.TKPREEQYN[H3N5F]STYR.V3,336.425P01857N180110
PE000945R.EEQYN[H3N5F]STYR.V2,854.129P01857N18080
PE001074R.EEQFN[H3N5F]STFR.V2,822.139P01859N17674
PE001042K.TKPREEQFN[H3N5F]STFR.V3,304.435P01859N17620
PE001425R.LSLHRPALEDLLLGSEAN[H3N5F]LTCTLTGLR.D4,628.215P01876N14410
PE001425R.LSLHRPALEDLLLGSEAN[H3N5F]LTCTLTGLR.D4,628.215P01877N13110
PE001579K.TQSLLIVNN[H3N5F]ATNVVIK.V3,391.623P0DTC2N12220
PE001586K.VCEFQFCNDPFLGVYYHKNN[H3N5F]K.S4,343.828P0DTC2N14920
PE001624K.TPPIKDFGGFN[H3N5F]FSQILPDPSKPSK.R4,281.983P0DTC2N80110
PE001599K.DFGGFN[H3N5F]FSQILPDPSKPSKR.S3,901.751P0DTC2N80110
PE001556K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H3N5F]FTTAPAICHDGK.A6,216.849P0DTC2N107410
PE001537R.EGVFVSN[H3N5F]GTHWFVTQR.N3,528.530P0DTC2N109820
PE002064R.VVRPDSELGERPPEDN[H3N5F]QSFQYDHEAFLGK.E5,024.209Q15293N5310
PE001768K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H3N5F]ITEENVQNMNNAGDKWSAFLK.E7,309.219Q9BYF1N5320
PE001732K.LQLQALQQN[H3N5F]GSSVLSEDKSK.R3,837.762Q9BYF1N10320
PE001740K.LQLQALQQN[H3N5F]GSSVLSEDKSKR.L3,993.864Q9BYF1N10330
PE001686R.IFKEAEKFFVSVGLPN[H3N5F]MTQGFWENSMLTDPGNVQK.A5,653.578Q9BYF1N32210
PE001681K.HEGPLHKCDISN[H3N5F]STEAGQK.L3,772.599Q9BYF1N54610
PE001775R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H3N5F]STEAGQK.L5,699.529Q9BYF1N54610