G94917XT

From GPTWiki
Jump to navigation Jump to search

Name(s) H6N5FS3
A3G3F1S3
FA3G3S3
HexNAc(5)Hex(6)Fuc(1)NeuAc(3)
HexNAc(5)Hex(6)dHex(1)NeuAc(3)
Molecular Weight 3025.0685275
Class(es) N-Glycan
GlyGen

G94917XT

GNOme

G94917XT

Topologies

Samples (Peptides)

Human Serum (65 / 66), SARS-CoV-2 Spike Protein (R683A, R685A) over-expressed in HEK293 Cells (1 / 66)

Peptides

 PeptideMol. Wt.ProteinSiteTrans. GroupsTransitions
PE000568K.EHEGAIYPDN[H6N5FS3]TTDFQR.A4,916.902P00450N1381246
PE000592K.EN[H6N5FS3]LTAPGSDSAVFFEQGTTR.I5,151.060P00450N39746
PE000640K.ELHHLQEQN[H6N5FS3]VSNAFLDKGEFYIGSK.Y5,927.493P00450N7621158
PE000608K.ELHHLQEQN[H6N5FS3]VSNAFLDK.G5,046.065P00450N762946
PE000153K.MVSHHN[H6N5FS3]LTTGATLINEQWLLTTAK.N5,703.454P00738N1841348
PE000124K.M[Ox]VSHHN[H6N5FS3]LTTGATLINEQWLLTTAK.N5,719.448P00738N184324
PE000066K.VVLHPN[H6N5FS3]YSQVDIGLIK.L4,819.072P00738N241837
PE000323K.ADTHDEILEGLNFN[H6N5FS3]LTEIPEAQIHEGFQELLR.T6,715.885P01009N1071458
PE000407K.ADTHDEILEGLNFN[H6N5FS3]LTEIPEAQIH.E5,743.382P01009N107116
PE000073K.YLGN[H6N5FS3]ATAIFFLPDEGKLQHLENELTHDIITK.F6,564.899P01009N271322
PE001375K.YLGN[H6N5FS3]ATAIFFLPDEGK.L4,779.956P01009N27119
PE000321K.APDKNVIFSPLSISTALAFLSLGAHN[H6N5FS3]TTLTEILK.G6,607.039P01011N93121
PE000401K.FN[H6N5FS3]LTETSEAEIHQSFQHLLR.T5,424.255P01011N106525
PE000082K.YTGN[H6N5FS3]ASALFILPDQDKMEEVEAMLLPETLKR.W6,546.847P01011N271436
PE000328K.YTGN[H6N5FS3]ASALFILPDQDK.M4,776.942P01011N271433
PE000080K.YTGN[H6N5FS3]ASALFILPDQDKMEEVEAMLLPETLK.R6,390.746P01011N271417
PE000409K.IITILEEEMN[H6N5FS3]VSVCGLYTYGKPVP.G5,749.444P01023N24719
PE000410E.MN[H6N5FS3]VSVCGLYTYGKPVPGHVTVSICRK.Y5,946.540P01023N247121
PE000322R.TEVSSNHVLIYLDKVSN[H6N5FS3]QTLSLFFTVLQDVPVRDLKPAIVK.V7,650.616P01023N1424110
PE000504R.HGIQYFNN[H6N5FS3]NTQHSSLFMLNEVKR.A5,801.419P01042N169126
PE000030R.ITYSIVQTN[H6N5FS3]CSKENFLFLTPDCK.S5,802.409P01042N205112
PE001814K.LNAENN[H6N5FS3]ATFYFK.I4,455.752P01042N294111
PE000374V.ACLVQGFFPQEPLSVTWSESGQN[H6N5FS3]VTAR.N6,032.518P01877N4717
PE000404A.CLVQGFFPQEPLSVTWSESGQN[H6N5FS3]VTAR.N5,961.481P01877N47118
PE000548R.VYKPSAGN[H6N5FS3]NSLYR.D4,492.816P02749N162949
PE000327R.SDHGSSISCQPPAEIPGYLPADTVHLAVEFFN[H6N5FS3]LTHLPANLLQGASK.L7,923.502P02750N79529
PE000412R.QLDMLDLSN[H6N5FS3]NSLASVPEGLWASLGQPNWDM.R6,325.612P02750N269131
PE000376L.LEAQIPLCANLVPVPITN[H6N5FS3]ATLDQITGK.W5,913.637P02763N33131
PE001855R.NEEYN[H6N5FS3]K.S3,820.408P02763N56111
PE001818K.WFYIASAFRNEEYN[H6N5FS3]K.S4,961.979P02763N56115
PE000210K.SVQEIQATFFYFTPN[H6N5FS3]KTEDTIFLR.E5,919.518P02763N72526
PE000625R.QDQCIYN[H6N5FS3]TTYLNVQR.E4,939.958P02763N93529
PE001864R.EN[H6N5FS3]GTISR.Y3,800.451P02763N103110
PE000335K.VCQDCPLLAPLN[H6N5FS3]DTR.V4,795.908P02765N156642
PE000336K.AALAAFNAQNN[H6N5FS3]GSNFQLEEISR.A5,389.214P02765N176516
PE000324R.QQQHLFGSN[H6N5FS3]VTDCSGNFCLFR.S5,539.185P02787N6301116
PE000634R.SWPAVGN[H6N5FS3]CSSALR.W4,428.730P02790N187110
PE000020R.FSLLGHASISCTVEN[H6N5FS3]ETIGVWRPSPPTCEK.I6,396.696P04003N221217
PE000601K.NN[H6N5FS3]ATVHEQVGGPSLTSDLQAQSK.G5,405.230P04004N86213
PE000643R.FEDGVLDPDYPRN[H6N5FS3]ISDGFDGIPDNVDAALALPAHSYSGR.E7,200.019P04004N242220
PE000532R.N[H6N5FS3]ISDGFDGIPDNVDAALALPAHSYSGR.E5,796.384P04004N242822
PE000586R.EGDHEFLEVPEAQEDVEATFPVHQPGN[H6N5FS3]YSCSYR.T6,860.738P04217N179334
PE000630R.REGDHEFLEVPEAQEDVEATFPVHQPGN[H6N5FS3]YSCSYR.T7,016.839P04217N179119
PE000579R.ADGTVNQIEGEATPVN[H6N5FS3]LTEPAKLEVK.F5,747.471P05090N98218
PE000063R.VLSN[H6N5FS3]NSDANLELINTWVAK.N5,125.154P05155N25335
PE000670K.GGETAQSADPQWEQLNNKN[H6N5FS3]LSMPLLPADFHK.E6,460.720P05546N49114
PE000403-.MGPLMVLFCLLFLYPGLADSAPSCPQNVN[H6N5FS3]ISG.G6,505.764P06681N2916
PE000330K.IPCSQPPQIEHGTIN[H6N5FS3]SSR.S5,045.048P08603N882272
PE000331R.ISEEN[H6N5FS3]ETTCYMGK.W4,585.712P08603N91118
PE000333R.SPYEMFGDEEVMCLNGN[H6N5FS3]WTEPPQCK.D6,042.303P08603N109515
... further results