P01877

From gptwiki
Jump to: navigation, search
Description Immunoglobulin heavy constant alpha 2
Gene IGHA2
Organism Homo sapiens
Species Homo sapiens
GlyGen P01877

Samples

Human Serum

Peptides

 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsTransitions
PE0003678K.VFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQN[H5N5F]VTAR.N51H5N5FN476,765.08415
PE00040426A.CLVQGFFPQEPLSVTWSESGQN[H6N5FS3]VTAR.N51H6N5FS3N475,961.481118
PE00037425V.ACLVQGFFPQEPLSVTWSESGQN[H6N5FS3]VTAR.N51H6N5FS3N476,032.51817
PE001060114R.LSLHRPALEDLLLGSEAN[H3N4]LTCTLTGLR.D140H3N4N1314,279.07818
PE001034114R.LSLHRPALEDLLLGSEAN[H3N5]LTCTLTGLR.D140H3N5N1314,482.1571123
PE001064119R.PALEDLLLGSEAN[H3N5]LTCTLTGLR.D140H3N5N1313,875.797412
PE001425114R.LSLHRPALEDLLLGSEAN[H3N5F]LTCTLTGLR.D140H3N5FN1314,628.21515
PE001077114R.LSLHRPALEDLLLGSEAN[H4N3]LTCTLTGLR.D140H4N3N1314,238.051212
PE001176114R.LSLHRPALEDLLLGSEAN[H4N3F2]LTCTLTGLR.D140H4N3F2N1314,530.16716
PE001393119R.PALEDLLLGSEAN[H4N3S]LTCTLTGLR.D140H4N3SN1313,922.78617
PE001036114R.LSLHRPALEDLLLGSEAN[H4N3S]LTCTLTGLR.D140H4N3SN1314,529.146516
PE001063114R.LSLHRPALEDLLLGSEAN[H4N4]LTCTLTGLR.D140H4N4N1314,441.130725
PE001066119R.PALEDLLLGSEAN[H4N4]LTCTLTGLR.D140H4N4N1313,834.77017
PE001175114R.LSLHRPALEDLLLGSEAN[H4N4F2]LTCTLTGLR.D140H4N4F2N1314,733.24615
PE001108119R.PALEDLLLGSEAN[H4N4F2S]LTCTLTGLR.D140H4N4F2SN1314,417.98119
PE000776114R.LSLHRPALEDLLLGSEAN[H4N4S]LTCTLTGLR.D140H4N4SN1314,732.226735
PE000828119R.PALEDLLLGSEAN[H4N4S]LTCTLTGLR.D140H4N4SN1314,125.86639
PE001035114R.LSLHRPALEDLLLGSEAN[H4N5]LTCTLTGLR.D140H4N5N1314,644.2101634
PE001067119R.PALEDLLLGSEAN[H4N5]LTCTLTGLR.D140H4N5N1314,037.850529
PE001079114R.LSLHRPALEDLLLGSEAN[H4N5F]LTCTLTGLR.D140H4N5FN1314,790.268414
PE001129114R.LSLHRPALEDLLLGSEAN[H4N5F2]LTCTLTGLR.D140H4N5F2N1314,936.32614
PE001117114R.LSLHRPALEDLLLGSEAN[H4N5FS]LTCTLTGLR.D140H4N5FSN1315,081.363113
PE000778114R.LSLHRPALEDLLLGSEAN[H4N5S]LTCTLTGLR.D140H4N5SN1314,935.3051636
PE000831119R.PALEDLLLGSEAN[H4N5S]LTCTLTGLR.D140H4N5SN1314,328.94535
PE000774114R.LSLHRPALEDLLLGSEAN[H5N2]LTCTLTGLR.D140H5N2N1314,197.024715
PE001061114R.LSLHRPALEDLLLGSEAN[H5N3]LTCTLTGLR.D140H5N3N1314,400.104314
PE001107119R.PALEDLLLGSEAN[H5N3S]LTCTLTGLR.D140H5N3SN1314,084.83939
PE001116114R.LSLHRPALEDLLLGSEAN[H5N3S]LTCTLTGLR.D140H5N3SN1314,691.199718
PE000090119R.PALEDLLLGSEAN[H5N4]LTCTLTGLR.D140H5N4N1313,996.823621
PE000070114R.LSLHRPALEDLLLGSEAN[H5N4]LTCTLTGLR.D140H5N4N1314,603.1831440
PE000089114R.LSLHRPALEDLLLGSEAN[H5N4F]LTCTLTGLR.D140H5N4FN1314,749.241116
PE000843114R.LSLHRPALEDLLLGSEAN[H5N4F2]LTCTLTGLR.D140H5N4F2N1314,895.299212
PE000829119R.PALEDLLLGSEAN[H5N4F2S]LTCTLTGLR.D140H5N4F2SN1314,580.034320
PE001125119R.PALEDLLLGSEAN[H5N4F4]LTCTLTGLR.D140H5N4F4N1314,581.05515
PE000154114R.LSLHRPALEDLLLGSEAN[H5N4FS]LTCTLTGLR.D140H5N4FSN1315,040.336428
PE000233114R.LSLHRPALEDLLLGSEAN[H5N4FS2]LTCTLTGLR.D140H5N4FS2N1315,331.432220
PE001392119R.PALEDLLLGSEAN[H5N4FS2]LTCTLTGLR.D140H5N4FS2N1314,725.07216
PE000131119R.PALEDLLLGSEAN[H5N4S]LTCTLTGLR.D140H5N4SN1314,287.918920
PE000126114R.LSLHRPALEDLLLGSEAN[H5N4S]LTCTLTGLR.D140H5N4SN1314,894.2792547
PE000002114R.LSLHRPALEDLLLGSEAN[H5N4S2]LTCTLTGLR.D140H5N4S2N1315,185.3741340
PE000195119R.PALEDLLLGSEAN[H5N4S2]LTCTLTGLR.D140H5N4S2N1314,579.014619
PE001065119R.PALEDLLLGSEAN[H5N5]LTCTLTGLR.D140H5N5N1314,199.902730
PE001062114R.LSLHRPALEDLLLGSEAN[H5N5]LTCTLTGLR.D140H5N5N1314,806.2631232
PE000357114R.LSLHRPALEDLLLGSEAN[H5N5F]LTCTLTGLR.D140H5N5FN1314,952.320211
PE001115114R.LSLHRPALEDLLLGSEAN[H5N5F2]LTCTLTGLR.D140H5N5F2N1315,098.378110
PE001033114R.LSLHRPALEDLLLGSEAN[H5N5FS]LTCTLTGLR.D140H5N5FSN1315,243.416313
PE000841114R.LSLHRPALEDLLLGSEAN[H5N5FS2]LTCTLTGLR.D140H5N5FS2N1315,534.511215
PE000827119R.PALEDLLLGSEAN[H5N5FS2]LTCTLTGLR.D140H5N5FS2N1314,928.15119
PE000777114R.LSLHRPALEDLLLGSEAN[H5N5S]LTCTLTGLR.D140H5N5SN1315,097.3582165
PE000830119R.PALEDLLLGSEAN[H5N5S]LTCTLTGLR.D140H5N5SN1314,490.998813
... further results