P01877

From GPTWiki
Jump to navigation Jump to search
Description Immunoglobulin heavy constant alpha 2
Gene IGHA2
Organism Homo sapiens
Species Homo sapiens
GlyGen P01877

Samples (Peptides)

Human Serum (71 / 71)

Peptides

 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsTransitions
PE0021788K.VFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQN[H5N4F]VTAR.N51H5N4FN476,562.00414
PE0003678K.VFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQN[H5N5F]VTAR.N51H5N5FN476,765.084110
PE00037425V.ACLVQGFFPQEPLSVTWSESGQN[H6N5FS3]VTAR.N51H6N5FS3N476,032.51817
PE00040426A.CLVQGFFPQEPLSVTWSESGQN[H6N5FS3]VTAR.N51H6N5FS3N475,961.481118
PE001064119R.PALEDLLLGSEAN[H3N5]LTCTLTGLR.D140H3N5N1313,875.797113
PE001034114R.LSLHRPALEDLLLGSEAN[H3N5]LTCTLTGLR.D140H3N5N1314,482.1571325
PE001425114R.LSLHRPALEDLLLGSEAN[H3N5F]LTCTLTGLR.D140H3N5FN1314,628.21515
PE001077114R.LSLHRPALEDLLLGSEAN[H4N3]LTCTLTGLR.D140H4N3N1314,238.051215
PE001176114R.LSLHRPALEDLLLGSEAN[H4N3F2]LTCTLTGLR.D140H4N3F2N1314,530.16716
PE001036114R.LSLHRPALEDLLLGSEAN[H4N3S]LTCTLTGLR.D140H4N3SN1314,529.146619
PE001393119R.PALEDLLLGSEAN[H4N3S]LTCTLTGLR.D140H4N3SN1313,922.78617
PE001063114R.LSLHRPALEDLLLGSEAN[H4N4]LTCTLTGLR.D140H4N4N1314,441.130325
PE001175114R.LSLHRPALEDLLLGSEAN[H4N4F2]LTCTLTGLR.D140H4N4F2N1314,733.24615
PE001108119R.PALEDLLLGSEAN[H4N4F2S]LTCTLTGLR.D140H4N4F2SN1314,417.981113
PE000828119R.PALEDLLLGSEAN[H4N4S]LTCTLTGLR.D140H4N4SN1314,125.86669
PE000776114R.LSLHRPALEDLLLGSEAN[H4N4S]LTCTLTGLR.D140H4N4SN1314,732.2261040
PE001067119R.PALEDLLLGSEAN[H4N5]LTCTLTGLR.D140H4N5N1314,037.850329
PE001035114R.LSLHRPALEDLLLGSEAN[H4N5]LTCTLTGLR.D140H4N5N1314,644.2101737
PE001079114R.LSLHRPALEDLLLGSEAN[H4N5F]LTCTLTGLR.D140H4N5FN1314,790.268415
PE001129114R.LSLHRPALEDLLLGSEAN[H4N5F2]LTCTLTGLR.D140H4N5F2N1314,936.326116
PE002130119R.PALEDLLLGSEAN[H4N5F2S]LTCTLTGLR.D140H4N5F2SN1314,621.061116
PE001117114R.LSLHRPALEDLLLGSEAN[H4N5FS]LTCTLTGLR.D140H4N5FSN1315,081.363114
PE000778114R.LSLHRPALEDLLLGSEAN[H4N5S]LTCTLTGLR.D140H4N5SN1314,935.3052044
PE000831119R.PALEDLLLGSEAN[H4N5S]LTCTLTGLR.D140H4N5SN1314,328.94535
PE000774114R.LSLHRPALEDLLLGSEAN[H5N2]LTCTLTGLR.D140H5N2N1314,197.024515
PE001107119R.PALEDLLLGSEAN[H5N3S]LTCTLTGLR.D140H5N3SN1314,084.839310
PE001116114R.LSLHRPALEDLLLGSEAN[H5N3S]LTCTLTGLR.D140H5N3SN1314,691.199823
PE000070114R.LSLHRPALEDLLLGSEAN[H5N4]LTCTLTGLR.D140H5N4N1314,603.1831242
PE000090119R.PALEDLLLGSEAN[H5N4]LTCTLTGLR.D140H5N4N1313,996.823524
PE000843114R.LSLHRPALEDLLLGSEAN[H5N4F2]LTCTLTGLR.D140H5N4F2N1314,895.299219
PE000829119R.PALEDLLLGSEAN[H5N4F2S]LTCTLTGLR.D140H5N4F2SN1314,580.034321
PE001853114R.LSLHRPALEDLLLGSEAN[H5N4F3]LTCTLTGLR.D140H5N4F3N1315,041.35715
PE001125119R.PALEDLLLGSEAN[H5N4F4]LTCTLTGLR.D140H5N4F4N1314,581.05516
PE000154114R.LSLHRPALEDLLLGSEAN[H5N4FS]LTCTLTGLR.D140H5N4FSN1315,040.336532
PE000233114R.LSLHRPALEDLLLGSEAN[H5N4FS2]LTCTLTGLR.D140H5N4FS2N1315,331.432221
PE001392119R.PALEDLLLGSEAN[H5N4FS2]LTCTLTGLR.D140H5N4FS2N1314,725.07216
PE000126114R.LSLHRPALEDLLLGSEAN[H5N4S]LTCTLTGLR.D140H5N4SN1314,894.2793348
PE000131119R.PALEDLLLGSEAN[H5N4S]LTCTLTGLR.D140H5N4SN1314,287.9181321
PE000195119R.PALEDLLLGSEAN[H5N4S2]LTCTLTGLR.D140H5N4S2N1314,579.014619
PE000002114R.LSLHRPALEDLLLGSEAN[H5N4S2]LTCTLTGLR.D140H5N4S2N1315,185.3742144
PE001062114R.LSLHRPALEDLLLGSEAN[H5N5]LTCTLTGLR.D140H5N5N1314,806.2631136
PE001065119R.PALEDLLLGSEAN[H5N5]LTCTLTGLR.D140H5N5N1314,199.902430
PE000357114R.LSLHRPALEDLLLGSEAN[H5N5F]LTCTLTGLR.D140N1314,952.320311
PE001115114R.LSLHRPALEDLLLGSEAN[H5N5F2]LTCTLTGLR.D140H5N5F2N1315,098.378112
PE001033114R.LSLHRPALEDLLLGSEAN[H5N5FS]LTCTLTGLR.D140H5N5FSN1315,243.416315
PE000827119R.PALEDLLLGSEAN[H5N5FS2]LTCTLTGLR.D140H5N5FS2N1314,928.151111
PE000841114R.LSLHRPALEDLLLGSEAN[H5N5FS2]LTCTLTGLR.D140H5N5FS2N1315,534.511217
PE000777114R.LSLHRPALEDLLLGSEAN[H5N5S]LTCTLTGLR.D140H5N5SN1315,097.3583071
PE000830119R.PALEDLLLGSEAN[H5N5S]LTCTLTGLR.D140H5N5SN1314,490.9981114
PE001109119R.PALEDLLLGSEAN[H5N5S2]LTCTLTGLR.D140H5N5S2N1314,782.093219
... further results