PE000020

From GPTWiki
Jump to navigation Jump to search
Name R.FSLLGHASISCTVEN[H6N5FS3]ETIGVWRPSPPTCEK.I
Sequence FSLLGHASISCTVENETIGVWRPSPPTCEK
Glycans(s) H6N5FS3 (N15)
Mod(s) 57.021 (C11), 57.021 (C28)
Molecular Weight 6396.696
Norm. RT 108.363
Protein C4BPA (P04003)

Samples

Human Serum

Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zMethodSpectraTransitions
TG00067654.70954.786107.8291,595.6864Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MSMS_35_Frac_plasma_run02_fr1015
TG00277054.73555.001108.8981,595.6864Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MSMS_35_Frac_plasma_run01_fr9_0114