PE000081

From GPTWiki
Jump to navigation Jump to search
Name K.YTGN[H6N5S3]ASALFILPDQDKMEEVEAMLLPETLKR.W
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLKR
Glycans(s) H6N5S3 (N4)
Mod(s)
Molecular Weight 6400.789
Norm. RT 167.839
Protein SERPINA3 (P01011)

Samples

Human Serum

Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zMethodSpectraTransitions
TG00065078.51478.479167.8391,596.7024Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MSMS_35_Frac_plasma_run02_fr1010
TG00065878.51478.472167.8211,277.5645Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MSMS_35_Frac_plasma_run02_fr1011
TG00517079.39679.324170.2411,277.5645Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MSMS_51_plasma_1ul12