PE000129

From GPTWiki
Jump to navigation Jump to search
Name R.FSLLGHASISCTVEN[H6N5S3]ETIGVWRPSPPTCEK.I
Sequence FSLLGHASISCTVENETIGVWRPSPPTCEK
Glycans(s) H6N5S3 (N15)
Mod(s) 57.021 (C11), 57.021 (C28)
Molecular Weight 6250.638
Norm. RT 108.145
Protein C4BPA (P04003)

Samples

Human Serum

Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zMethodSpectraTransitions
TG00064354.80254.958108.2641,559.1714Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MSMS_35_Frac_plasma_run02_fr1014
TG00068354.80254.864108.0261,247.5385Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MSMS_35_Frac_plasma_run02_fr104
TG00274054.92855.112109.1791,247.5385Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MSMS_35_Frac_plasma_run01_fr9_014
TG00336256.38456.270107.6021,247.5385Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MSMS_48_UO1_Erlic_E76