PE000162

From GPTWiki
Jump to navigation Jump to search
Name K.IQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFN[H6N5S3]CSESFTMIGHR.S
Sequence IQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHR
Glycans(s) H6N5S3 (N48)
Mod(s) 57.021 (C3), 57.021 (C14), 57.021 (C21), 57.021 (C49)
Molecular Weight 9731.028
Norm. RT 166.700
Protein CFH (P08603)

Samples

Human Serum

Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zMethodSpectraTransitions
TG00039784.55584.796166.7001,619.8526Orbitrap Fusion-Lumos, DDA (HCD pd EThcD), nano LC-MS/MSMS_24_UO1_CFH_UO14