PE000252

From GPTWiki
Jump to navigation Jump to search
Name R.TEVSSNHVLIYLDKVSN[H6N5S3]QTLSLFFTVLQDVPVRDLKPAIVK.V
Sequence TEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVRDLKPAIVK
Glycans(s) H6N5S3 (N17)
Mod(s)
Molecular Weight 7504.558
Norm. RT 200.195
Protein A2M (P01023)

Samples

Human Serum

Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zMethodSpectraTransitions
TG00031485.33585.636200.1951,248.7666Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MSMS_31_UO1_MARS_MS2_1ug_longn_CE20_std11