PE000260

From GPTWiki
Jump to navigation Jump to search
Name K.YLGN[H6N5S3]ATAIFFLPDEGKLQHLENELTHDIITK.F
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H6N5S3 (N4)
Mod(s)
Molecular Weight 6418.841
Norm. RT 160.580
Protein SERPINA1 (P01009)

Samples

Human Serum

Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zMethodSpectraTransitions
TG00024271.73871.833163.0461,281.1745Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MSMS_31_UO1_MARS_MS2_1ug_longn_CE20_std10
TG00070475.53275.444160.3431,281.1745Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MSMS_35_Frac_plasma_run02_fr1115
TG00271975.25975.195160.0891,281.1745Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MSMS_35_Frac_plasma_run01_fr9_0113
TG00520976.20975.827160.8171,281.1745Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MSMS_51_plasma_1ul15