PE000271

From GPTWiki
Jump to navigation Jump to search
Name R.SDHGSSISCQPPAEIPGYLPADTVHLAVEFFN[H6N5S3]LTHLPANLLQGASK.L
Sequence SDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASK
Glycans(s) H6N5S3 (N32)
Mod(s) 57.021 (C9)
Molecular Weight 7777.444
Norm. RT 195.014
Protein LRG1 (P02750)

Samples

Human Serum

Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zMethodSpectraTransitions
TG00028783.81883.711195.0141,294.2496Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MSMS_31_UO1_MARS_MS2_1ug_longn_CE20_std4