PE000339

From GPTWiki
Jump to navigation Jump to search
Name K.YTGN[H6N5F]ASALFILPDQDKMEEVEAMLLPETLKR.W
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLKR
Glycans(s) H6N5F (N4)
Mod(s)
Molecular Weight 5673.561
Norm. RT
Protein SERPINA3 (P01011)

Samples

Transition Groups