PE000345

From GPTWiki
Jump to navigation Jump to search
Name R.SDHGSSISCQPPAEIPGYLPADTVHLAVEFFN[H6N5F]LTHLPANLLQGASK.L
Sequence SDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASK
Glycans(s) H6N5F (N32)
Mod(s) 57.021 (C9)
Molecular Weight 7050.216
Norm. RT
Protein LRG1 (P02750)

Samples

Transition Groups