PE000358

From GPTWiki
Jump to navigation Jump to search
Name K.HLQMDIHIFEPQGISFLETESTFMTNQLVDALTTWQN[H5N4]K.T
Sequence HLQMDIHIFEPQGISFLETESTFMTNQLVDALTTWQNK
Glycans(s) H5N4 (N37)
Mod(s)
Molecular Weight 6102.754
Norm. RT
Protein ITIH4 (Q14624)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00018980.71979.6871,522.1944OrbitrapHuman Serum4