PE000411

From GPTWiki
Jump to navigation Jump to search
Name R.QLDMLDLSN[H6N5F]NSLASVPEGLWASLGQPNWDM.R
Sequence QLDMLDLSNNSLASVPEGLWASLGQPNWDM
Glycans(s) H6N5F (N9)
Mod(s)
Molecular Weight 5452.325
Norm. RT 20.202
Protein LRG1 (P02750)

Samples

Human Serum

Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zMethodSpectraTransitions
TG00050025.21025.26520.2021,359.5874Orbitrap Fusion-Lumos, DDA (HCD pd EThcD), nano LC-MS/MSMS_24_UO1_IGM_UO111