PE000439

From GPTWiki
Jump to navigation Jump to search
Name R.NQALN[H5N4S2]LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR.N
Sequence NQALNLSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR
Glycans(s) H5N4S2 (N5)
Mod(s)
Molecular Weight 6860.046
Norm. RT 139.912
Protein ITIH4 (Q14624)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00020767.77667.363140.0491,369.4155OrbitrapHuman Serum11
TG00091067.90767.730139.9121,369.4155OrbitrapHuman Serum11
TG00080267.58667.646139.7241,369.4155OrbitrapHuman Serum9

DIA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleIntensity
TG00851652.65752.657163.8171,369.4155TripleTOFHuman Serum84,728.3
TG01024851.61051.610153.3981,369.4155TripleTOFHuman Serum38,406.8