PE000628

From GPTWiki
Jump to navigation Jump to search
Name R.REGDHEFLEVPEAQEDVEATFPVHQPGN[H6N5S3]YSCSYR.T
Sequence REGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H6N5S3 (N28)
Mod(s) 57.021 (C31)
Molecular Weight 6870.781
Norm. RT
Protein A1BG (P04217)

Samples

Human Serum

Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zMethodSpectraTransitions
TG00129645.90545.71683.5141,371.5655Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MSMS_35_Frac_plasma_run02_fr713