PE001179

From GPTWiki
Jump to navigation Jump to search
Name R.NQALN[H6N5S3]LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR.N
Sequence NQALNLSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR
Glycans(s) H6N5S3 (N5)
Mod(s)
Molecular Weight 7516.274
Norm. RT 156.268
Protein ITIH4 (Q14624)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00343673.93074.566155.3571,500.6605OrbitrapHuman Serum8
TG00278773.67673.761156.3821,250.7186OrbitrapHuman Serum9
TG00508174.29474.310156.7281,500.6605OrbitrapHuman Serum12
TG00278273.67673.672156.1541,500.6605OrbitrapHuman Serum8