PE001223

From GPTWiki
Jump to navigation Jump to search
Name K.GGETAQSADPQWEQLNNKN[H6N5S3]LSMPLLPADFHK.E
Sequence GGETAQSADPQWEQLNNKNLSMPLLPADFHK
Glycans(s) H6N5S3 (N19)
Mod(s)
Molecular Weight 6314.662
Norm. RT 101.351
Protein SERPIND1 (P05546)

Samples

Human Serum

Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zMethodSpectraTransitions
TG00283752.82452.706101.3511,575.1714Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MSMS_35_Frac_plasma_run01_fr8_0113