PE001269

From GPTWiki
Jump to navigation Jump to search
Name R.VVRPDSELGERPPEDN[H5N2]QSFQYDHEAFLGKEDSK.T
Sequence VVRPDSELGERPPEDNQSFQYDHEAFLGKEDSK
Glycans(s) H5N2 (N16)
Mod(s)
Molecular Weight 5052.215
Norm. RT 23.747
Protein RCN1 (Q15293)

Samples

HEK293 Cells

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00639222.59622.53723.7471,007.8495OrbitrapHEK293 Cells4
TG00638722.67722.69323.752840.0426OrbitrapHEK293 Cells14
TG00288222.59622.50823.677840.0426OrbitrapHEK293 Cells14