PE001548

From GPTWiki
Jump to navigation Jump to search
Name K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N5F]FTTAPAICHDGK.A
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H6N5F (N29)
Mod(s) 57.021 (C37)
Molecular Weight 6703.008
Norm. RT 62.184
Protein S (P0DTC2)

Samples

SARS-CoV-2 Spike Protein (R683A, R685A) over-expressed in HEK293 Cells

Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zMethodSpectraTransitions
TG00408939.45538.42561.4801,115.1766Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MSMS_50_Covid_spike_trypsin_new28
TG00411539.45538.70562.184956.0097Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MSMS_50_Covid_spike_trypsin_new28
TG00429340.14140.53866.3881,115.1766Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MSMS_50_Covid_spike_trypsin_new8