PE001754

From GPTWiki
Jump to navigation Jump to search
Name K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H5N4FS]ITEENVQNMNNAGDKWSAFLK.E
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H5N4FS (N27)
Mod(s)
Molecular Weight 7721.341
Norm. RT 154.283
Protein ACE2 (Q9BYF1)

Samples

Human ACE2 Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00480375.14975.064153.5601,284.8966OrbitrapHuman ACE2 Protein8
TG00469275.08775.178155.0061,284.8966OrbitrapHuman ACE2 Protein9
TG00478875.14975.032153.4791,541.6745OrbitrapHuman ACE2 Protein10
TG00468375.08775.184155.0211,541.6745OrbitrapHuman ACE2 Protein8