PE001759

From GPTWiki
Jump to navigation Jump to search
Name K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H4N5FS]ITEENVQNMNNAGDKWSAFLK.E
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H4N5FS (N27)
Mod(s)
Molecular Weight 7762.367
Norm. RT 155.270
Protein ACE2 (Q9BYF1)

Samples

Human ACE2 Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00469975.50875.282155.2701,549.8795OrbitrapHuman ACE2 Protein9