PE001766

From GPTWiki
Jump to navigation Jump to search
Name K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H4N4]ITEENVQNMNNAGDKWSAFLK.E
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H4N4 (N27)
Mod(s)
Molecular Weight 7122.135
Norm. RT 143.751
Protein ACE2 (Q9BYF1)

Samples

Human ACE2 Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00481471.18470.870143.0261,421.8335OrbitrapHuman ACE2 Protein9
TG00472071.65371.029144.4761,421.8335OrbitrapHuman ACE2 Protein7