PE001779

From GPTWiki
Jump to navigation Jump to search
Name K.FNHEAEDLFYQSSLASWNYNTN[H3N5]ITEENVQNMNNAGDKWSAFLK.E
Sequence FNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H3N5 (N22)
Mod(s)
Molecular Weight 6558.839
Norm. RT 122.416
Protein ACE2 (Q9BYF1)

Samples

Human ACE2 Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00480462.65862.664122.4161,309.1745OrbitrapHuman ACE2 Protein5