Q14624@N577

From GPTWiki
Jump to navigation Jump to search
Protein ITIH4 (Q14624)
Site N577
GlyGen Q14624@N577

Samples (Peptides)

Human Serum (9 / 9)

Peptides

 StartPeptideEndGlycanMol. Wt.Trans. GroupsDIA Trans. Groups
PE000535573R.NQALN[H5N4S]LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR.N614H5N4S6,568.95110
PE000439573R.NQALN[H5N4S2]LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR.N614H5N4S26,860.04652
PE000438573R.NQALN[H5N4S2]LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPM[Ox]EGESR.N614H5N4S26,876.04130
PE000382573R.NQALN[H6N5F]LSLAYSFVTPLTSMVVTKPD.D597H6N5F4,860.19210
PE001389573R.NQALN[H6N5FS2]LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR.N614H6N5FS27,371.23610
PE000440573R.NQALN[H6N5FS3]LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR.N614H6N5FS37,662.33110
PE001387573R.NQALN[H6N5S2]LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR.N614H6N5S27,225.17810
PE001179573R.NQALN[H6N5S3]LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR.N614H6N5S37,516.27440
PE001388573R.NQALN[H8N7F]LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR.N614H8N7F7,519.31010