TG000207

From GPTWiki
Jump to navigation Jump to search
Peptide R.NQALN[H5N4S2]LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR.N (PE000439)
Sequence NQALNLSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR
Glycans(s) H5N4S2 (N5)
Mod(s)
Molecular Weight 6,860.046
Charge 5+
Protein ITIH4 (Q14624)
Spectrum File MS_35_Frac_plasma_run01_fr10_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
67.776 67.363 140.049 1,369.415 5+ 1,547.460 4+ Y[pH4N3S] 22.7
67.776 67.363 140.049 1,369.415 5+ 1,614.455 3+ Y[pN] 21.7
67.776 67.363 140.049 1,369.415 5+ 1,474.686 4+ Y[pH4N3] 19.2
67.776 67.363 140.049 1,369.415 5+ 1,844.201 3+ Y[pH3N2] 16.7
67.776 67.363 140.049 1,369.415 5+ 1,790.184 3+ Y[pH2N2] 14.1
67.776 67.363 140.049 1,369.415 5+ 1,434.173 4+ Y[pH3N3] 10.6
67.776 67.363 140.049 1,369.415 5+ 1,211.093 4+ Y[pN] 9.9
67.776 67.363 140.049 1,369.415 5+ 1,506.947 4+ Y[pH3N3S] 9.4
67.776 67.363 140.049 1,369.415 5+ 1,546.762 3+ Y[p] 6.5
67.776 67.363 140.049 1,369.415 5+ 1,638.743 4+ Y[pH5N4S] 5.9
67.776 67.363 140.049 1,369.415 5+ 1,565.969 4+ Y[pH5N4] 5.3

Spectra

17154;EThcD;67.494;17146;1369.410;Byonic:q-value=6.77e-15/GPS:MinICScore=25.504
17156;HCD;67.499;17146;1369.410;
17316;EThcD;68.048;17311;1369.608;Byonic:q-value=0.00109/GPS:MinICScore=234.105
17318;HCD;68.053;17311;1369.608;