TG000802

From GPTWiki
Jump to navigation Jump to search
Peptide R.NQALN[H5N4S2]LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR.N (PE000439)
Sequence NQALNLSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR
Glycans(s) H5N4S2 (N5)
Mod(s)
Molecular Weight 6,860.046
Charge 5+
Protein ITIH4 (Q14624)
Spectrum File MS_35_Frac_plasma_run02_fr12
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
67.586 67.646 139.724 1,369.415 5+ 1,614.455 3+ Y[pN] 22.9
67.586 67.646 139.724 1,369.415 5+ 1,547.460 4+ Y[pH4N3S] 17.5
67.586 67.646 139.724 1,369.415 5+ 1,844.201 3+ Y[pH3N2] 17.3
67.586 67.646 139.724 1,369.415 5+ 1,790.184 3+ Y[pH2N2] 17.0
67.586 67.646 139.724 1,369.415 5+ 1,474.686 4+ Y[pH4N3] 14.9
67.586 67.646 139.724 1,369.415 5+ 1,434.173 4+ Y[pH3N3] 8.0
67.586 67.646 139.724 1,369.415 5+ 1,211.093 4+ Y[pN] 7.9
67.586 67.646 139.724 1,369.415 5+ 1,506.947 4+ Y[pH3N3S] 7.3
67.586 67.646 139.724 1,369.415 5+ 1,736.166 3+ Y[pHN2] 5.2

Spectra

16431;EThcD;67.580;16419;1369.612;Byonic:q-value=3.48e-13/GPS:MinICScore=51.222
16433;HCD;67.586;16419;1369.612;