TG000910

From GPTWiki
Jump to navigation Jump to search
Peptide R.NQALN[H5N4S2]LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR.N (PE000439)
Sequence NQALNLSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR
Glycans(s) H5N4S2 (N5)
Mod(s)
Molecular Weight 6,860.046
Charge 5+
Protein ITIH4 (Q14624)
Spectrum File MS_35_Frac_plasma_run02_fr13
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
67.907 67.730 139.912 1,369.415 5+ 1,547.460 4+ Y[pH4N3S] 28.8
67.907 67.730 139.912 1,369.415 5+ 1,614.455 3+ Y[pN] 25.3
67.907 67.730 139.912 1,369.415 5+ 1,474.686 4+ Y[pH4N3] 24.0
67.907 67.730 139.912 1,369.415 5+ 1,844.201 3+ Y[pH3N2] 19.3
67.907 67.730 139.912 1,369.415 5+ 1,790.184 3+ Y[pH2N2] 16.8
67.907 67.730 139.912 1,369.415 5+ 1,434.173 4+ Y[pH3N3] 12.9
67.907 67.730 139.912 1,369.415 5+ 1,211.093 4+ Y[pN] 10.3
67.907 67.730 139.912 1,369.415 5+ 1,506.947 4+ Y[pH3N3S] 10.0
67.907 67.730 139.912 1,369.415 5+ 1,546.762 3+ Y[p] 6.5
67.907 67.730 139.912 1,369.415 5+ 1,565.969 4+ Y[pH5N4] 5.7
67.907 67.730 139.912 1,369.415 5+ 1,638.743 4+ Y[pH5N4S] 5.6

Spectra

16265;EThcD;67.899;16264;1369.613;Byonic:q-value=6.73e-06/GPS:MinICScore=24.965
16267;HCD;67.907;16264;1369.613;