TG001130

From GPTWiki
Jump to navigation Jump to search
Peptide R.NQALN[H5N4S]LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR.N (PE000535)
Sequence NQALNLSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR
Glycans(s) H5N4S (N5)
Mod(s)
Molecular Weight 6,568.951
Charge 5+
Protein ITIH4 (Q14624)
Spectrum File MS_35_Frac_plasma_run02_fr17
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
62.169 1,311.196 5+ 1,474.686 4+ Y[pH4N3] 44.3
62.169 1,311.196 5+ 1,614.455 3+ Y[pN] 33.4
62.169 1,311.196 5+ 1,434.173 4+ Y[pH3N3] 23.5
62.169 1,311.196 5+ 1,844.201 3+ Y[pH3N2] 22.5
62.169 1,311.196 5+ 1,790.184 3+ Y[pH2N2] 19.6
62.169 1,311.196 5+ 1,547.460 4+ Y[pH4N3S] 14.2
62.169 1,311.196 5+ 1,211.093 4+ Y[pN] 11.2
62.169 1,311.196 5+ 1,565.969 4+ Y[pH5N4] 8.5
62.169 1,311.196 5+ 1,342.890 4+ Y[pH2N2] 6.6
62.169 1,311.196 5+ 1,736.166 3+ Y[pHN2] 6.5
62.169 1,311.196 5+ 1,506.947 4+ Y[pH3N3S] 6.2
62.169 1,311.196 5+ 1,383.403 4+ Y[pH3N2] 5.8
62.169 1,311.196 5+ 1,965.912 3+ Y[pH4N3] 5.2
62.169 1,311.196 5+ 1,546.762 3+ Y[p] 5.1
62.169 1,311.196 5+ 1,682.148 3+ Y[pN2] 5.0

Spectra

15242;EThcD;62.164;15235;1311.200;Byonic:q-value=5.69e-08/GPS:MinICScore=159.674
15244;HCD;62.169;15235;1311.200;