TG002782

From GPTWiki
Jump to navigation Jump to search
Peptide R.NQALN[H6N5S3]LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR.N (PE001179)
Sequence NQALNLSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR
Glycans(s) H6N5S3 (N5)
Mod(s)
Molecular Weight 7,516.274
Charge 5+
Protein ITIH4 (Q14624)
Spectrum File MS_35_Frac_plasma_run01_fr10_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
73.676 73.672 156.154 1,500.660 5+ 1,614.455 3+ Y[pN] 14.9
73.676 73.672 156.154 1,500.660 5+ 1,506.947 4+ Y[pH3N3S] 11.0
73.676 73.672 156.154 1,500.660 5+ 1,711.517 4+ Y[pH5N4S2] 10.1
73.676 73.672 156.154 1,500.660 5+ 1,790.184 3+ Y[pH2N2] 8.7
73.676 73.672 156.154 1,500.660 5+ 1,434.173 4+ Y[pH3N3] 7.0
73.676 73.672 156.154 1,500.660 5+ 1,638.743 4+ Y[pH5N4S] 6.6
73.676 73.672 156.154 1,500.660 5+ 1,965.912 3+ Y[pH4N3] 6.5
73.676 73.672 156.154 1,500.660 5+ 1,211.093 4+ Y[pN] 5.2

Spectra

18946;EThcD;73.616;18944;1500.853;Byonic:q-value=4.61e-14/GPS:MinICScore=147.489
18948;HCD;73.623;18944;1500.853;
19068;EThcD;74.079;19059;1500.655;Byonic:q-value=4.73e-12/GPS:MinICScore=90.811
19070;HCD;74.087;19059;1500.655;