TG002787

From GPTWiki
Jump to navigation Jump to search
Peptide R.NQALN[H6N5S3]LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR.N (PE001179)
Sequence NQALNLSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR
Glycans(s) H6N5S3 (N5)
Mod(s)
Molecular Weight 7,516.274
Charge 6+
Protein ITIH4 (Q14624)
Spectrum File MS_35_Frac_plasma_run01_fr10_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
73.676 73.761 156.382 1,250.718 6+ 1,614.455 3+ Y[pN] 21.2
73.676 73.761 156.382 1,250.718 6+ 1,211.093 4+ Y[pN] 14.2
73.676 73.761 156.382 1,250.718 6+ 1,474.686 4+ Y[pH4N3] 9.9
73.676 73.761 156.382 1,250.718 6+ 1,790.184 3+ Y[pH2N2] 9.8
73.676 73.761 156.382 1,250.718 6+ 1,342.890 4+ Y[pH2N2] 8.7
73.676 73.761 156.382 1,250.718 6+ 1,434.173 4+ Y[pH3N3] 8.7
73.676 73.761 156.382 1,250.718 6+ 1,547.460 4+ Y[pH4N3S] 7.6
73.676 73.761 156.382 1,250.718 6+ 1,844.201 3+ Y[pH3N2] 7.1
73.676 73.761 156.382 1,250.718 6+ 1,638.743 4+ Y[pH5N4S] 5.5

Spectra

18962;EThcD;73.670;18960;1251.051;Byonic:q-value=0.00104/GPS:MinICScore=206.457
18964;HCD;73.676;18960;1251.051;