TG003436

From GPTWiki
Jump to navigation Jump to search
Peptide R.NQALN[H6N5S3]LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR.N (PE001179)
Sequence NQALNLSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR
Glycans(s) H6N5S3 (N5)
Mod(s)
Molecular Weight 7,516.274
Charge 5+
Protein ITIH4 (Q14624)
Spectrum File MS_48_UO1_Erlic_E7
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
73.930 74.566 155.357 1,500.660 5+ 1,638.743 4+ Y[pH5N4S] 15.9
73.930 74.566 155.357 1,500.660 5+ 1,614.455 3+ Y[pN] 14.3
73.930 74.566 155.357 1,500.660 5+ 1,506.947 4+ Y[pH3N3S] 8.3
73.930 74.566 155.357 1,500.660 5+ 1,211.093 4+ Y[pN] 7.6
73.930 74.566 155.357 1,500.660 5+ 1,711.517 4+ Y[pH5N4S2] 7.5
73.930 74.566 155.357 1,500.660 5+ 1,565.969 4+ Y[pH5N4] 7.4
73.930 74.566 155.357 1,500.660 5+ 1,434.173 4+ Y[pH3N3] 7.1
73.930 74.566 155.357 1,500.660 5+ 1,790.184 3+ Y[pH2N2] 7.0

Spectra

19143;EThcD;73.924;19138;1500.865;Byonic:q-value=0.00146/GPS:MinICScore=136.620
19145;HCD;73.930;19138;1500.865;