TG004683

From GPTWiki
Jump to navigation Jump to search
Peptide K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H5N4FS]ITEENVQNMNNAGDKWSAFLK.E (PE001754)
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H5N4FS (N27)
Mod(s)
Molecular Weight 7,721.341
Charge 5+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
75.087 75.184 155.021 1,541.674 5+ 1,462.677 4+ Y[pN] 40.7
75.087 75.184 155.021 1,541.674 5+ 1,762.783 4+ Y[pH4N3F] 14.3
75.087 75.184 155.021 1,541.674 5+ 1,499.191 4+ Y[pNF]* 12.2
75.087 75.184 155.021 1,541.674 5+ 1,685.756 4+ Y[pH3N3] 10.0
75.087 75.184 155.021 1,541.674 5+ 1,512.462 5+ Y[pH5N4S] 9.0
75.087 75.184 155.021 1,541.674 5+ 1,722.270 4+ Y[pH3N3F] 8.3
75.087 75.184 155.021 1,541.674 5+ 1,513.446 4+ Y[pN2] 7.5
75.087 75.184 155.021 1,541.674 5+ 1,483.455 5+ Y[pH5N4F] 5.2

Spectra

15682;EThcD;74.661;15680;1541.683;Byonic:q-value=2.1e-07/GPS:MinICScore=32.685
15684;HCD;74.671;15680;1541.683;