TG005081

From GPTWiki
Jump to navigation Jump to search
Peptide R.NQALN[H6N5S3]LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR.N (PE001179)
Sequence NQALNLSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR
Glycans(s) H6N5S3 (N5)
Mod(s)
Molecular Weight 7,516.274
Charge 5+
Protein ITIH4 (Q14624)
Spectrum File MS_51_plasma_1ul
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
74.294 74.310 156.728 1,500.660 5+ 1,711.517 4+ Y[pH5N4S2] 31.9
74.294 74.310 156.728 1,500.660 5+ 1,638.743 4+ Y[pH5N4S] 27.9
74.294 74.310 156.728 1,500.660 5+ 1,506.947 4+ Y[pH3N3S] 24.1
74.294 74.310 156.728 1,500.660 5+ 1,614.455 3+ Y[pN] 16.4
74.294 74.310 156.728 1,500.660 5+ 1,790.184 3+ Y[pH2N2] 11.1
74.294 74.310 156.728 1,500.660 5+ 1,565.969 4+ Y[pH5N4] 10.9
74.294 74.310 156.728 1,500.660 5+ 1,965.912 3+ Y[pH4N3] 10.3
74.294 74.310 156.728 1,500.660 5+ 1,434.173 4+ Y[pH3N3] 10.0
74.294 74.310 156.728 1,500.660 5+ 1,211.093 4+ Y[pN] 7.6
74.294 74.310 156.728 1,500.660 5+ 1,484.943 4+ Y[pH3N4] 6.3
74.294 74.310 156.728 1,500.660 5+ 1,911.894 3+ Y[pH3N3] 5.9
74.294 74.310 156.728 1,500.660 5+ 1,598.230 4+ Y[pH4N4S] 5.2

Spectra

16196;EThcD;74.283;16194;1501.069;Byonic:q-value=3.26e-05/GPS:MinICScore=597.530
16198;HCD;74.294;16194;1501.069;