TG008516

From GPTWiki
Jump to navigation Jump to search
Peptide R.NQALN[H5N4S2]LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR.N (PE000439)
Sequence NQALNLSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR
Glycans(s) H5N4S2 (N5)
Mod(s)
Molecular Weight 6,860.046
Charge 5+
Protein ITIH4 (Q14624)
Spectrum File DataMS_Human_serum_MARS14_DIA_lce02
Method Applied Biosystems TripleTOF 6600, DIA (HCD), nano LC-MS/MS
Analytical Fraction MARS14 Depleted
Sample Human Serum
Extraction OpenSWATH
Intensity 84728.300
Score 2.589
FDR 0%

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
52.657 52.657 163.817 1,369.415 5+ 1,547.460 4+ Y[pH4N3S] 100.0
52.657 52.657 163.817 1,369.415 5+ 1,474.686 4+ Y[pH4N3] 63.1
52.657 52.657 163.817 1,369.415 5+ 1,844.201 3+ Y[pH3N2] 49.4
52.657 52.657 163.817 1,369.415 5+ 1,790.184 3+ Y[pH2N2] 40.3
52.657 52.657 163.817 1,369.415 5+ 1,614.455 3+ Y[pN] 37.5
52.657 52.657 163.817 1,369.415 5+ 1,434.173 4+ Y[pH3N3] 28.1
52.657 52.657 163.817 1,369.415 5+ 1,506.947 4+ Y[pH3N3S] 20.4
52.657 52.657 163.817 1,369.415 5+ 1,211.093 4+ Y[pN] 16.4
52.657 52.657 163.817 1,369.415 5+ 1,638.743 4+ Y[pH5N4S] 14.0
52.657 52.657 163.817 1,369.415 5+ 1,565.969 4+ Y[pH5N4] 12.4
52.657 52.657 163.817 1,369.415 5+ 1,736.166 3+ Y[pHN2] 6.8
52.657 52.657 163.817 1,369.415 5+ 1,546.762 3+ Y[p] 2.7