G44211QA

From GPTWiki
Jump to navigation Jump to search
The printable version is no longer supported and may have rendering errors. Please update your browser bookmarks and please use the default browser print function instead.

Name(s) H6N5F
A3G3F1
FA3G3
HexNAc(5)Hex(6)Fuc(1)
HexNAc(5)Hex(6)dHex(1)
Molecular Weight 2151.78227759
Class(es) N-Glycan
GlyGen

G44211QA

GNOme

G44211QA

Topologies

Samples (Peptides)

Human Serum (11 / 15), NIST IgG Standard Reference (2 / 15), SARS-CoV-2 Spike Protein (R683A, R685A) over-expressed in HEK293 Cells (2 / 15)

Peptides

 PeptideMol. Wt.ProteinSiteTrans. GroupsTransitions
PE000377Q.SN[H6N5F]STNIFFSPVSIATAFAMLSLGTK.A4,755.113P01009N70110
PE000381S.N[H6N5F]STNIFFSPVSIATAFAMLSLGTK.A4,668.081P01009N70114
PE000386R.EEQYN[H6N5F]STYR.V3,340.287P01857N180513
PE000389K.TKPREEQYN[H6N5F]STYR.V3,822.584P01857N1801041
PE000413K.STGKPTLYN[H6N5F]VSLVM[Ox]SDT.A3,979.675P01871N44014
PE001174R.LSLHRPALEDLLLGSEAN[H6N5F]LTCTLTGLR.D5,114.373P01876N144314
PE001174R.LSLHRPALEDLLLGSEAN[H6N5F]LTCTLTGLR.D5,114.373P01877N131314
PE000405A.MFGN[H6N5F]DTITCTTHGNWTK.L4,134.644P02749N18317
PE000411R.QLDMLDLSN[H6N5F]NSLASVPEGLWASLGQPNWDM.R5,452.325P02750N269111
PE000383N.LVPVPITN[H6N5F]ATLDQITGK.W3,930.796P02763N3319
PE000461R.ADGTVNQIEGEATPVN[H6N5F]LTEPAKLEVK.F4,874.185P05090N9816
PE000384K.MLFVEPILEVSSLPTTN[H6N5F]STTNSAT.K4,703.055P05155N6915
PE001548K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N5F]FTTAPAICHDGK.A6,703.008P0DTC2N1074317
PE001519R.EGVFVSN[H6N5F]GTHWFVTQR.N4,014.689P0DTC2N109826
PE000385K.M[Ox]LN[H6N5F]TSSLLEQLNEQFNWVSRL.A4,689.041P10909N354121
PE000382R.NQALN[H6N5F]LSLAYSFVTPLTSMVVTKPD.D4,860.192Q14624N57719